BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0844 (363 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34555.1 68417.m04910 40S ribosomal protein S25, putative 68 2e-12 At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) 68 2e-12 At4g39200.1 68417.m05550 40S ribosomal protein S25 (RPS25E) ribo... 67 4e-12 At2g21580.1 68415.m02567 40S ribosomal protein S25 (RPS25B) 66 5e-12 At5g64950.1 68418.m08170 mitochondrial transcription termination... 29 0.93 At1g14500.1 68414.m01719 ankyrin repeat family protein contains ... 29 1.2 At2g17250.1 68415.m01992 expressed protein weak similarity to Ri... 27 2.8 At2g23170.1 68415.m02768 auxin-responsive GH3 family protein sim... 27 4.9 At1g24706.1 68414.m03104 expressed protein 27 4.9 At1g48180.1 68414.m05378 expressed protein ; expression supporte... 26 6.5 At5g38830.1 68418.m04697 tRNA synthetase class I (C) family prot... 26 8.6 At5g27640.1 68418.m03311 eukaryotic translation initiation facto... 26 8.6 At4g36670.1 68417.m05203 mannitol transporter, putative similar ... 26 8.6 At4g27630.1 68417.m03971 expressed protein 26 8.6 At3g19960.1 68416.m02526 myosin (ATM) nearly identical to myosin... 26 8.6 At2g02810.1 68415.m00226 UDP-galactose/UDP-glucose transporter c... 26 8.6 >At4g34555.1 68417.m04910 40S ribosomal protein S25, putative Length = 108 Score = 68.1 bits (159), Expect = 2e-12 Identities = 29/51 (56%), Positives = 42/51 (82%) Frame = +2 Query: 116 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDLGKK 268 +NN VLFD+ TY+KL E P++KLITP+++S+RL++ GSLARRA+ +L K Sbjct: 37 VNNMVLFDQATYDKLLSEAPKFKLITPSILSDRLRINGSLARRAIRELMAK 87 Score = 30.7 bits (66), Expect = 0.30 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 241 KSTHRLREKGLIKQVVQHHGQVIYTRATKG 330 ++ L KG I+ V H Q IYTRAT G Sbjct: 79 RAIRELMAKGTIRMVSAHSSQQIYTRATHG 108 >At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) Length = 125 Score = 68.1 bits (159), Expect = 2e-12 Identities = 28/48 (58%), Positives = 41/48 (85%) Frame = +2 Query: 116 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDL 259 +NN VLFD+ TY+KL E P++KLITP+++S+RL++ GSLAR+A+ DL Sbjct: 53 VNNMVLFDQATYDKLMSEAPKFKLITPSILSDRLRINGSLARKAIRDL 100 >At4g39200.1 68417.m05550 40S ribosomal protein S25 (RPS25E) ribosomal protein S25, Lycopersicon esculentum, PIR2:S40089 Length = 108 Score = 66.9 bits (156), Expect = 4e-12 Identities = 28/51 (54%), Positives = 42/51 (82%) Frame = +2 Query: 116 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDLGKK 268 +NN VLFD+ TY+KL E P++KLITP+++S+R+++ GSLARRA+ +L K Sbjct: 37 VNNMVLFDQATYDKLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAK 87 Score = 30.3 bits (65), Expect = 0.40 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 241 KSTHRLREKGLIKQVVQHHGQVIYTRAT 324 ++ L KG+I+ V H Q IYTRAT Sbjct: 79 RAIRELMAKGVIRMVAAHSSQQIYTRAT 106 >At2g21580.1 68415.m02567 40S ribosomal protein S25 (RPS25B) Length = 108 Score = 66.5 bits (155), Expect = 5e-12 Identities = 28/51 (54%), Positives = 42/51 (82%) Frame = +2 Query: 116 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDLGKK 268 +NN VLFD+ TY+KL E P++KLITP+++S+R+++ GSLARRA+ +L K Sbjct: 37 VNNMVLFDQGTYDKLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAK 87 Score = 30.7 bits (66), Expect = 0.30 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 241 KSTHRLREKGLIKQVVQHHGQVIYTRAT 324 ++ L KGLI+ V H Q IYTRAT Sbjct: 79 RAIRELMAKGLIRMVSAHSSQQIYTRAT 106 >At5g64950.1 68418.m08170 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 391 Score = 29.1 bits (62), Expect = 0.93 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -1 Query: 351 SLCDWIIALGRTRVDHLPMVLDYLFDETFFPKSMSALLAREPRTFNLSD 205 S C W++ + LP + YL +++LL R+PR FNLS+ Sbjct: 166 SRCGWLLLSRDPNLFLLPNI-SYLETCGIVGSQLASLLRRQPRIFNLSE 213 >At1g14500.1 68414.m01719 ankyrin repeat family protein contains Pfam domain, PF00023: Ankyrin repeat Length = 436 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -1 Query: 180 YCGTSLYSFSYVGLSN--NTWLFNLSRTFPLDHFFFLALPPPDPSFFFC 40 +C LY+F + + + TW F + + + + +A+ P+P F C Sbjct: 342 FCCALLYTFCLLPIGSLFTTWFFWIGASLGVSYALAMAIISPNPLLFLC 390 >At2g17250.1 68415.m01992 expressed protein weak similarity to Ribosome biogenesis protein MAK21 (Swiss-Prot:Q12176) [Saccharomyces cerevisiae] Length = 577 Score = 27.5 bits (58), Expect = 2.8 Identities = 11/36 (30%), Positives = 24/36 (66%) Frame = +2 Query: 119 NNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVR 226 +++ + +KPT +K E L++PA +S+R+K++ Sbjct: 245 SDESISEKPTDKKKKTEKGDSTLLSPATISKRMKLK 280 >At2g23170.1 68415.m02768 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 595 Score = 26.6 bits (56), Expect = 4.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 154 LICGFIKQHLVVQLVTNFSFGPLLLLGFAAT 62 ++CG + +H V++L F+ G L +GF T Sbjct: 213 MLCGLLMRHEVLRLGAVFASGLLRAIGFLQT 243 >At1g24706.1 68414.m03104 expressed protein Length = 1781 Score = 26.6 bits (56), Expect = 4.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 117 NLSRTFPLDHFFFLALPPPDP 55 +L ++ P DHF LPPP P Sbjct: 1562 SLEKSHPDDHFHSQGLPPPPP 1582 >At1g48180.1 68414.m05378 expressed protein ; expression supported by MPSS Length = 239 Score = 26.2 bits (55), Expect = 6.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 213 LSDTTAGVISLYCGTSLYSFSYVGL 139 L + + +YCGTS SYVGL Sbjct: 149 LQQDASAITGIYCGTSGEPASYVGL 173 >At5g38830.1 68418.m04697 tRNA synthetase class I (C) family protein similar to SP|Q06752 Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cysteine--tRNA ligase) (CysRS) {Bacillus subtilis}; contains Pfam profile PF01406: tRNA synthetases class I (C) Length = 511 Score = 25.8 bits (54), Expect = 8.6 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 201 TAGVISLY-CGTSLYSFSYVG 142 T G I LY CG + Y FS++G Sbjct: 25 TPGKIGLYVCGITAYDFSHIG 45 >At5g27640.1 68418.m03311 eukaryotic translation initiation factor 3 subunit 9 / eIF-3 eta / eIF3b (TIF3B1) nearly identical to SP|Q9C5Z1 Eukaryotic translation initiation factor 3 subunit 9 (eIF-3 eta) (eIF3 p110) (eIF3b) {Arabidopsis thaliana} Length = 712 Score = 25.8 bits (54), Expect = 8.6 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -1 Query: 180 YCGTSLYSFSYVGLSNNTWLFNLSRTFPL--DHFFFLALPPPDPSF 49 Y T++ S + W FN + + DHFF LA P PSF Sbjct: 566 YVATAVTSVHEMENGFTIWSFNGIMLYRILKDHFFQLAWRPRPPSF 611 >At4g36670.1 68417.m05203 mannitol transporter, putative similar to mannitol transporter [Apium graveolens var. dulce] GI:12004316; contains Pfam profile PF00083: major facilitator superfamily protein Length = 493 Score = 25.8 bits (54), Expect = 8.6 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 192 VISLYCGTSLYSFSYVGLSNNTWLFNLSRTFPL 94 V+S+ S +F +GL TW+++ S FPL Sbjct: 377 VLSIVAAYSFVAFFSIGLGPITWVYS-SEVFPL 408 >At4g27630.1 68417.m03971 expressed protein Length = 348 Score = 25.8 bits (54), Expect = 8.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 308 ITCPWCWTTCLMRPFSL 258 I P CWTT L PF L Sbjct: 4 ILSPTCWTTLLKHPFIL 20 >At3g19960.1 68416.m02526 myosin (ATM) nearly identical to myosin [Arabidopsis thaliana] GI:6491702; similar to myosin GI:6491702 from [Arabidopsis thaliana] ;contains Pfam profiles: PF00063: myosin head (motor domain), PF00612: IQ calmodulin-binding motif; identical to cDNA myosin (ATM) GI:297068 Length = 1166 Score = 25.8 bits (54), Expect = 8.6 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 176 QYKLITPAVVSERLKVRGSLARRALIDLGKKVSSNR*SNTMG 301 QYK I A V + +RG L RR D+G S +N +G Sbjct: 907 QYKGIADASVVIQSAIRGWLVRRCSGDIGWLKSGGAKTNELG 948 >At2g02810.1 68415.m00226 UDP-galactose/UDP-glucose transporter contains transmembrane domains; identical to UDP-galactose/UDP-glucose transporter (GI:22651763) [Arabidopsis thaliana] similar to UGTrel1 (GI:1669564) [Rattus rattus]; identical to cDNA UDP-galactose/UDP-glucose transporter GI:22651762 Length = 332 Score = 25.8 bits (54), Expect = 8.6 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 175 WDFLVQFLICGFIKQHLVVQLVTNF 101 WD L ++ ICG + Q+ + ++NF Sbjct: 245 WDIL-KYCICGAVGQNFIFMTISNF 268 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,426,668 Number of Sequences: 28952 Number of extensions: 174033 Number of successful extensions: 562 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 467982008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -