BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0842 (414 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 3.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 3.6 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 20 8.3 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 20 8.3 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 20 8.3 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 3.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 205 ECLRRLIKCVANPAILFLRGLVGMIAISSHILLFV 101 +CL +L K + L L G AI S IL+FV Sbjct: 143 KCLYKLWKMPSLSEFLSLFGTETCPAIGSAILIFV 177 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 3.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 205 ECLRRLIKCVANPAILFLRGLVGMIAISSHILLFV 101 +CL +L K + L L G AI S IL+FV Sbjct: 143 KCLYKLWKMPSLSEFLSLFGTETCPAIGSAILIFV 177 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 20.2 bits (40), Expect = 8.3 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = +1 Query: 325 YVEDAGLQQY*WPATNTASYPGW 393 YV+D+ ++ WP A+ W Sbjct: 527 YVDDSSVESRVWPRAAAAAERLW 549 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 20.2 bits (40), Expect = 8.3 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 123 LHIFFYLYQNQVLILYSI 70 LH+FF+ N++L Y + Sbjct: 118 LHVFFFTLFNKLLGQYPV 135 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 20.2 bits (40), Expect = 8.3 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 221 DSSHLRVSETPH 186 D+SH R+SE P+ Sbjct: 302 DTSHNRISEIPN 313 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,702 Number of Sequences: 336 Number of extensions: 1796 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9068614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -