BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0828 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 23 3.4 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 7.8 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 445 NYYNYGFHLIIFINYLKLIKI-LFISIYISKEPYR 546 NY NY L INY++ I + + + +Y P R Sbjct: 100 NYNNYNKKLYYNINYIEQIPVPVPVPVYCGNFPPR 134 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 191 LARKPSKLNKLTQNLITLLTFPDA 262 L R P L K+ QN T PDA Sbjct: 895 LIRSPDTLRKIAQNRGTNPLAPDA 918 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,823 Number of Sequences: 438 Number of extensions: 2697 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -