BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0823 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 114 2e-27 AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. 23 6.3 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 23 6.3 AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. 23 6.3 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 6.3 AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive ... 23 6.3 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 8.3 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 114 bits (275), Expect = 2e-27 Identities = 50/84 (59%), Positives = 62/84 (73%) Frame = +2 Query: 257 SIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKHEEKKDQHGYISRQFTRRYALPX 436 ++ KDKFQ+NLDVQ F+PEEISVK D ++VEGKHEEK+D HGY+SR F RRY LP Sbjct: 7 AVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLPK 66 Query: 437 GCTAESVESRLSSDGVLSVIAPRK 508 G + S LSSDG+L++ PRK Sbjct: 67 GHNEADIVSSLSSDGILTITCPRK 90 >AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 584 WSFTSLRTGPVWAIGILRSP 525 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 584 WSFTSLRTGPVWAIGILRSP 525 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 584 WSFTSLRTGPVWAIGILRSP 525 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 6.3 Identities = 19/93 (20%), Positives = 42/93 (45%), Gaps = 11/93 (11%) Frame = +2 Query: 299 VQHFAPEEISVKTADGYIVVEGKH---------EEKKDQHGYISRQFTRRYALPXGCTAE 451 ++ + PEE +V ++ + +V+G+ E + ++ Y S + + ++ Sbjct: 68 IEKYCPEEYTVDPSNTFQLVQGRELTKPSRRVLEGQSERESYYSSSHYQSSSSSSSSSSF 127 Query: 452 SVESRLSSDGVLSV--IAPRKCRQQWRVNARFR 544 S S G S+ I+P++ + R+N FR Sbjct: 128 QQSSYESESGAGSIVQISPQRVSLKLRLNEAFR 160 >AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive alpha-macroglobulinand complement C3-related protein IMCR14 protein. Length = 119 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 584 WSFTSLRTGPVWAIGILRSP 525 W T PV+ +GI++ P Sbjct: 81 WHLTGFSIDPVYGLGIIKQP 100 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.0 bits (47), Expect = 8.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 584 WSFTSLRTGPVWAIGILRSP 525 W T PV+ +GI++ P Sbjct: 659 WYLTGFSIDPVYGLGIIKKP 678 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,429 Number of Sequences: 2352 Number of extensions: 14038 Number of successful extensions: 33 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -