BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0821 (389 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34555.1 68417.m04910 40S ribosomal protein S25, putative 68 2e-12 At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) 68 2e-12 At4g39200.1 68417.m05550 40S ribosomal protein S25 (RPS25E) ribo... 67 5e-12 At2g21580.1 68415.m02567 40S ribosomal protein S25 (RPS25B) 66 6e-12 At5g64950.1 68418.m08170 mitochondrial transcription termination... 29 1.1 At1g14500.1 68414.m01719 ankyrin repeat family protein contains ... 29 1.5 At5g55500.1 68418.m06912 beta-(1,2)-xylosyltransferase (XYLT) id... 27 3.4 At2g17250.1 68415.m01992 expressed protein weak similarity to Ri... 27 3.4 At2g23170.1 68415.m02768 auxin-responsive GH3 family protein sim... 27 5.9 At1g24706.1 68414.m03104 expressed protein 27 5.9 At1g48180.1 68414.m05378 expressed protein ; expression supporte... 26 7.8 >At4g34555.1 68417.m04910 40S ribosomal protein S25, putative Length = 108 Score = 68.1 bits (159), Expect = 2e-12 Identities = 29/51 (56%), Positives = 42/51 (82%) Frame = +2 Query: 116 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDLGKK 268 +NN VLFD+ TY+KL E P++KLITP+++S+RL++ GSLARRA+ +L K Sbjct: 37 VNNMVLFDQATYDKLLSEAPKFKLITPSILSDRLRINGSLARRAIRELMAK 87 Score = 30.7 bits (66), Expect = 0.36 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 241 KSTHRLREKGLIKQVVQHHGQVIYTRATKG 330 ++ L KG I+ V H Q IYTRAT G Sbjct: 79 RAIRELMAKGTIRMVSAHSSQQIYTRATHG 108 >At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) Length = 125 Score = 68.1 bits (159), Expect = 2e-12 Identities = 28/48 (58%), Positives = 41/48 (85%) Frame = +2 Query: 116 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDL 259 +NN VLFD+ TY+KL E P++KLITP+++S+RL++ GSLAR+A+ DL Sbjct: 53 VNNMVLFDQATYDKLMSEAPKFKLITPSILSDRLRINGSLARKAIRDL 100 >At4g39200.1 68417.m05550 40S ribosomal protein S25 (RPS25E) ribosomal protein S25, Lycopersicon esculentum, PIR2:S40089 Length = 108 Score = 66.9 bits (156), Expect = 5e-12 Identities = 28/51 (54%), Positives = 42/51 (82%) Frame = +2 Query: 116 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDLGKK 268 +NN VLFD+ TY+KL E P++KLITP+++S+R+++ GSLARRA+ +L K Sbjct: 37 VNNMVLFDQATYDKLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAK 87 Score = 30.3 bits (65), Expect = 0.48 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 241 KSTHRLREKGLIKQVVQHHGQVIYTRAT 324 ++ L KG+I+ V H Q IYTRAT Sbjct: 79 RAIRELMAKGVIRMVAAHSSQQIYTRAT 106 >At2g21580.1 68415.m02567 40S ribosomal protein S25 (RPS25B) Length = 108 Score = 66.5 bits (155), Expect = 6e-12 Identities = 28/51 (54%), Positives = 42/51 (82%) Frame = +2 Query: 116 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDLGKK 268 +NN VLFD+ TY+KL E P++KLITP+++S+R+++ GSLARRA+ +L K Sbjct: 37 VNNMVLFDQGTYDKLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAK 87 Score = 30.7 bits (66), Expect = 0.36 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 241 KSTHRLREKGLIKQVVQHHGQVIYTRAT 324 ++ L KGLI+ V H Q IYTRAT Sbjct: 79 RAIRELMAKGLIRMVSAHSSQQIYTRAT 106 >At5g64950.1 68418.m08170 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 391 Score = 29.1 bits (62), Expect = 1.1 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -3 Query: 351 SLCDWIIALGRTRVDHLPMVLDYLFDETFFPKSMSALLAREPRTFNLSD 205 S C W++ + LP + YL +++LL R+PR FNLS+ Sbjct: 166 SRCGWLLLSRDPNLFLLPNI-SYLETCGIVGSQLASLLRRQPRIFNLSE 213 >At1g14500.1 68414.m01719 ankyrin repeat family protein contains Pfam domain, PF00023: Ankyrin repeat Length = 436 Score = 28.7 bits (61), Expect = 1.5 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -3 Query: 180 YCGTSLYSFSYVGLSN--NTWLFNLSRTFPLDHFFFLALPPPDPSFFFC 40 +C LY+F + + + TW F + + + + +A+ P+P F C Sbjct: 342 FCCALLYTFCLLPIGSLFTTWFFWIGASLGVSYALAMAIISPNPLLFLC 390 >At5g55500.1 68418.m06912 beta-(1,2)-xylosyltransferase (XYLT) identical to SP|Q9LDH0 Length = 534 Score = 27.5 bits (58), Expect = 3.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 375 FYFFNLYHSLCDWIIALGRTRVDHLP 298 F + NL+H++ DW A +RV LP Sbjct: 244 FEYANLFHTVTDWYSAYVSSRVTGLP 269 >At2g17250.1 68415.m01992 expressed protein weak similarity to Ribosome biogenesis protein MAK21 (Swiss-Prot:Q12176) [Saccharomyces cerevisiae] Length = 577 Score = 27.5 bits (58), Expect = 3.4 Identities = 11/36 (30%), Positives = 24/36 (66%) Frame = +2 Query: 119 NNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVR 226 +++ + +KPT +K E L++PA +S+R+K++ Sbjct: 245 SDESISEKPTDKKKKTEKGDSTLLSPATISKRMKLK 280 >At2g23170.1 68415.m02768 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 595 Score = 26.6 bits (56), Expect = 5.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -2 Query: 154 LICGFIKQHLVVQLVTNFSFGPLLLLGFAAT 62 ++CG + +H V++L F+ G L +GF T Sbjct: 213 MLCGLLMRHEVLRLGAVFASGLLRAIGFLQT 243 >At1g24706.1 68414.m03104 expressed protein Length = 1781 Score = 26.6 bits (56), Expect = 5.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 117 NLSRTFPLDHFFFLALPPPDP 55 +L ++ P DHF LPPP P Sbjct: 1562 SLEKSHPDDHFHSQGLPPPPP 1582 >At1g48180.1 68414.m05378 expressed protein ; expression supported by MPSS Length = 239 Score = 26.2 bits (55), Expect = 7.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 213 LSDTTAGVISLYCGTSLYSFSYVGL 139 L + + +YCGTS SYVGL Sbjct: 149 LQQDASAITGIYCGTSGEPASYVGL 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,581,176 Number of Sequences: 28952 Number of extensions: 179101 Number of successful extensions: 570 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 557595584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -