BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0820 (588 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118519-1|AAM49888.1| 104|Drosophila melanogaster LD16736p pro... 32 0.50 L14644-1|AAB88625.1| 2895|Drosophila melanogaster hyperplastic d... 29 3.5 AE014297-1012|AAF54431.2| 2885|Drosophila melanogaster CG9484-PA... 29 3.5 AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 29 6.2 >AY118519-1|AAM49888.1| 104|Drosophila melanogaster LD16736p protein. Length = 104 Score = 32.3 bits (70), Expect = 0.50 Identities = 21/54 (38%), Positives = 24/54 (44%) Frame = -3 Query: 190 SNKSCKLHLHQVKLHKRDNKHTFQRVWRDAQCS*GKQVVAVCMDFFHSSLYHIP 29 S KSC LH K D+ HT +R A C G+Q V D HS IP Sbjct: 19 SGKSCLLHHFIESKFKDDSSHTIGVEFRLADCERGRQ-VGKATDMGHSRSGEIP 71 >L14644-1|AAB88625.1| 2895|Drosophila melanogaster hyperplastic discs protein protein. Length = 2895 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/52 (30%), Positives = 21/52 (40%) Frame = +1 Query: 121 GKCACCPACVTLLGEGATCKIYSKELGETPSAVCKEPLKCIKRV*LSLCSRF 276 G CC C + +G CK+ K T C E KC + +L RF Sbjct: 1236 GSLCCCTECARVCHKGHDCKL--KRTAPTAYCDCWEKCKCKALIAGNLTKRF 1285 >AE014297-1012|AAF54431.2| 2885|Drosophila melanogaster CG9484-PA protein. Length = 2885 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/52 (30%), Positives = 21/52 (40%) Frame = +1 Query: 121 GKCACCPACVTLLGEGATCKIYSKELGETPSAVCKEPLKCIKRV*LSLCSRF 276 G CC C + +G CK+ K T C E KC + +L RF Sbjct: 1243 GSLCCCTECARVCHKGHDCKL--KRTAPTAYCDCWEKCKCKALIAGNLTKRF 1292 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 28.7 bits (61), Expect = 6.2 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Frame = +1 Query: 43 DYCEKNPCIQPPLVCPKNTEHR-ARHAGKCACCPACVTLLGEGA--TCKIYSKELGETPS 213 D+ +KNPC+ P C +N+E + + C+C P + G C I S + G+T S Sbjct: 9092 DHPKKNPCVPSP--CGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINS-DCGDTLS 9148 Query: 214 AV---CKEP 231 + C +P Sbjct: 9149 CINHKCVDP 9157 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,952,814 Number of Sequences: 53049 Number of extensions: 538722 Number of successful extensions: 1224 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1223 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2358819486 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -