BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0819 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5300| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35355| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) 72 4e-13 SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) 72 4e-13 SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_32791| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) 72 4e-13 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) 72 4e-13 SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 72 4e-13 SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) 71 7e-13 SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) 71 1e-12 SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) 68 6e-12 SB_47751| Best HMM Match : Histone (HMM E-Value=4.3e-07) 64 1e-10 SB_21745| Best HMM Match : Histone (HMM E-Value=1.1e-08) 64 1e-10 SB_11407| Best HMM Match : Histone (HMM E-Value=1.1e-08) 64 1e-10 SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07) 64 1e-10 SB_27350| Best HMM Match : Histone (HMM E-Value=1.1e-08) 64 1e-10 SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) 52 3e-07 SB_10761| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_17103| Best HMM Match : Histone (HMM E-Value=0.65) 50 2e-06 SB_35876| Best HMM Match : Histone (HMM E-Value=5.1) 49 4e-06 SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 48 6e-06 SB_45897| Best HMM Match : Peptidase_C50 (HMM E-Value=2.7e-08) 29 3.6 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 29 3.6 SB_35943| Best HMM Match : MFS_1 (HMM E-Value=1.5e-05) 29 3.6 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 4.8 SB_50573| Best HMM Match : WH1 (HMM E-Value=0.0015) 29 4.8 SB_49221| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_31724| Best HMM Match : Histone (HMM E-Value=4.8e-18) 28 6.3 SB_8207| Best HMM Match : SHD1 (HMM E-Value=4) 28 6.3 SB_46747| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 >SB_5300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 81.0 bits (191), Expect = 8e-16 Identities = 44/64 (68%), Positives = 49/64 (76%), Gaps = 1/64 (1%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE-APTCVLFTPNV*PSCRRIFNL 447 QRLVREIAQDFKTDLRFQSAAIGALQEA+EAYLVGLFE C + V C++ + Sbjct: 66 QRLVREIAQDFKTDLRFQSAAIGALQEAAEAYLVGLFEDTNLCAIHAKRV-TLCQKTSSS 124 Query: 446 LDES 435 LDES Sbjct: 125 LDES 128 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 42 GTVALREIRRYQKSTELLIRKLPFQRLVRE 71 >SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 19 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 56 Score = 64.9 bits (151), Expect = 6e-11 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA*ISLI 406 L TNLCAIHAKRVTIMPKDIQLARRIRGERA +L+ Sbjct: 54 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERAMSTLV 91 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 676 IRRYQKSTELLIRKLPFPSVL*E 608 IRRYQKSTELLIRKLPF ++ E Sbjct: 2 IRRYQKSTELLIRKLPFQRLVRE 24 >SB_35355| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 94 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 27 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 64 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 62 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 94 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 3 GTVALREIRRYQKSTELLIRKLPFQRLVRE 32 >SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 260 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 193 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 230 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 228 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 260 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 169 GTVALREIRRYQKSTELLIRKLPFQRLVRE 198 >SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) Length = 110 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLA 445 L TNLCAIHAKRVTIMPKDIQLA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLA 128 >SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 205 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 138 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 175 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 173 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 205 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 114 GTVALREIRRYQKSTELLIRKLPFQRLVRE 143 >SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 131 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 64 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 101 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 99 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 131 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 40 GTVALREIRRYQKSTELLIRKLPFQRLVRE 69 >SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_32791| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 94 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 27 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 64 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 62 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 94 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 3 GTVALREIRRYQKSTELLIRKLPFQRLVRE 32 >SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) Length = 162 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQ 451 L TNLCAIHAKRVTIMPKDI+ Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIR 126 >SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) Length = 370 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 51.2 bits (117), Expect = 8e-07 Identities = 35/95 (36%), Positives = 51/95 (53%), Gaps = 1/95 (1%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*EKSLRI-SKLICVSSLPPSELSRRQARLISL 521 GTVA REIRRYQKSTELLIRKLPF ++ E + + L SS + +A L+ L Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104 Query: 520 ACSKHQLVCYSRQTCDHHAEGYSTCSTNPW*TCLN 416 + ++++ +G+ C +PW +N Sbjct: 105 FEDTNLCAIHAKRV-TIMPQGHPACPPHPWRESVN 138 >SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) Length = 136 Score = 71.3 bits (167), Expect = 7e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS A+ ALQEASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSLAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) Length = 136 Score = 70.5 bits (165), Expect = 1e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ AL+EASEAYLVGLFE Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALKEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 70.1 bits (164), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRL+REIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFE Sbjct: 69 QRLIREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLIRE 74 >SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 Q LVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFE Sbjct: 69 QLLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFE 106 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPF 626 GTVA REIRRYQKSTELLIRKLPF Sbjct: 45 GTVALREIRRYQKSTELLIRKLPF 68 >SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) Length = 117 Score = 68.1 bits (159), Expect = 6e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVG E Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGFIE 106 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_47751| Best HMM Match : Histone (HMM E-Value=4.3e-07) Length = 55 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 23 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 55 >SB_21745| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 14 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 46 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 554 ALQEASEAYLVGLFE 510 ALQEASEAYLVGLFE Sbjct: 2 ALQEASEAYLVGLFE 16 >SB_11407| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 14 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 46 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 554 ALQEASEAYLVGLFE 510 ALQEASEAYLVGLFE Sbjct: 2 ALQEASEAYLVGLFE 16 >SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07) Length = 407 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 375 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 407 >SB_27350| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 64.1 bits (149), Expect = 1e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 519 LVRSTNLCAIHAKRVTIMPKDIQLARRIRGERA 421 L TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 14 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 46 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 554 ALQEASEAYLVGLFE 510 ALQEASEAYLVGLFE Sbjct: 2 ALQEASEAYLVGLFE 16 >SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEA 540 QRLVREIAQDFKTDLRFQS+A+ ALQEA Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEA 96 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) Length = 97 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEA 540 QRLVREIAQDFKTDLRFQS+A+ ALQEA Sbjct: 69 QRLVREIAQDFKTDLRFQSSAVMALQEA 96 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_10761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE 510 QRLVREI+Q+++ DLRF A+ ALQEA+EA++VG+F+ Sbjct: 107 QRLVREISQNYRLDLRFHPDALLALQEATEAFIVGVFD 144 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -3 Query: 504 NLCAIHAKRVTIMPKDIQLARRIRG 430 NLCAIHAKRVTIMPKD+ LA RIRG Sbjct: 147 NLCAIHAKRVTIMPKDLHLALRIRG 171 Score = 36.3 bits (80), Expect = 0.024 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*EKS 602 G A +EIR+ QKSTELLI+K+PF ++ E S Sbjct: 83 GRKALKEIRKLQKSTELLIKKVPFQRLVREIS 114 >SB_17103| Best HMM Match : Histone (HMM E-Value=0.65) Length = 97 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 623 QRLVREIAQDFKTDLRFQSAAIGALQEA 540 QRLVREIAQDFKTDLRFQS+A ALQEA Sbjct: 69 QRLVREIAQDFKTDLRFQSSARMALQEA 96 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 >SB_35876| Best HMM Match : Histone (HMM E-Value=5.1) Length = 157 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPFPSVL*E 608 GTVA REIRRYQKSTELLIRKLPF ++ E Sbjct: 45 GTVALREIRRYQKSTELLIRKLPFQRLVRE 74 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 623 QRLVREIAQDFKT 585 QRLVREIAQDFKT Sbjct: 69 QRLVREIAQDFKT 81 >SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 68 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELLIRKLPF 626 GTVA REIRRYQKSTELLIRKLPF Sbjct: 45 GTVALREIRRYQKSTELLIRKLPF 68 >SB_45897| Best HMM Match : Peptidase_C50 (HMM E-Value=2.7e-08) Length = 1907 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = -2 Query: 670 RYQKSTELLIRKLPFPSVL*EKSLRISKLICVSSLPPSELSRRQARLISLACSKHQLVCY 491 +YQ ++ L+R FP L ++ + L+ + P S + S +KH+ V + Sbjct: 588 KYQLLSDCLVRTQSFPEALSSSTISVMLLLSAAEYPEECSSEMHQAIFSWVKTKHKFVKH 647 Query: 490 SR 485 ++ Sbjct: 648 AQ 649 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 697 GTVAPREIRRYQKSTELL 644 GTVA REIRRYQKS + L Sbjct: 45 GTVALREIRRYQKSGDPL 62 >SB_35943| Best HMM Match : MFS_1 (HMM E-Value=1.5e-05) Length = 514 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 124 NLQSHLTQIRHPWAFSVTNEPYTILHDHI 210 ++Q H + PWA + +EP T LHD++ Sbjct: 179 SIQDH-GNLPRPWALQLMDEPVTSLHDNV 206 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 648 CLSVSCPFPASCERNRSGFQN*FAFPVCRHRSSP 547 CL +SC F + C ++ G N C H SP Sbjct: 229 CLKISCKFHSRCVKSSGGSANCVCPSDCSHTYSP 262 >SB_50573| Best HMM Match : WH1 (HMM E-Value=0.0015) Length = 554 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 522 NEISLACLLESSDGGRLETQISFEILSDFSHKTLGKGSLRISN 650 NEIS CL TQ+S E+ S+ SH S R+ N Sbjct: 181 NEISSPCLFSHVTSITTATQVSDEVDSNTSHSDSNHDSKRVMN 223 >SB_49221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +2 Query: 464 GMMVTRLA*IAHKLV 508 GMMVTRLA +AHKLV Sbjct: 10 GMMVTRLAWMAHKLV 24 >SB_31724| Best HMM Match : Histone (HMM E-Value=4.8e-18) Length = 150 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +2 Query: 464 GMMVTRLA*IAHKLV 508 GMMVTRLA +AHKLV Sbjct: 10 GMMVTRLAWMAHKLV 24 >SB_8207| Best HMM Match : SHD1 (HMM E-Value=4) Length = 208 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 Query: 473 VTRLA*IAHKLVLRTSQRDKPRLPPGELRWRQTGNANQF*NPERFL 610 VT+L H L + T + KP +PP E R N + N E FL Sbjct: 97 VTKLRLSNHNLAIETGRHAKPYVPPNERRCTICKNGIE--NEEHFL 140 >SB_46747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 Query: 473 VTRLA*IAHKLVLRTSQRDKPRLPPGELRWRQTGNANQF*NPERFL 610 VT+L H L + T + KP +PP E R N + N E FL Sbjct: 465 VTKLRLSNHNLAIETGRHAKPYVPPNERRCTICKNGIE--NEEHFL 508 >SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 Query: 473 VTRLA*IAHKLVLRTSQRDKPRLPPGELRWRQTGNANQF*NPERFL 610 VT+L H L + T + KP +PP E R N + N E FL Sbjct: 440 VTKLRLSNHNLAIETGRHAKPYVPPNERRCTICKNGIE--NEEHFL 483 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,100,012 Number of Sequences: 59808 Number of extensions: 384832 Number of successful extensions: 891 Number of sequences better than 10.0: 71 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 887 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -