BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0815 (627 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5300| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_35355| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) 64 7e-11 SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_32791| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) 64 7e-11 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) 64 7e-11 SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 64 7e-11 SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 7e-11 SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) 64 1e-10 SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) 63 2e-10 SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) 60 1e-09 SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) 56 2e-08 SB_47751| Best HMM Match : Histone (HMM E-Value=4.3e-07) 51 9e-07 SB_21745| Best HMM Match : Histone (HMM E-Value=1.1e-08) 51 9e-07 SB_11407| Best HMM Match : Histone (HMM E-Value=1.1e-08) 51 9e-07 SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07) 51 9e-07 SB_27350| Best HMM Match : Histone (HMM E-Value=1.1e-08) 51 9e-07 SB_10761| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) 29 2.3 SB_35943| Best HMM Match : MFS_1 (HMM E-Value=1.5e-05) 29 3.1 SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_48360| Best HMM Match : EGF (HMM E-Value=0.1) 29 4.1 SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_31651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_33974| Best HMM Match : Coprogen_oxidas (HMM E-Value=0) 27 9.4 SB_14248| Best HMM Match : AAA_5 (HMM E-Value=7.7e-14) 27 9.4 SB_23898| Best HMM Match : Ldl_recept_a (HMM E-Value=1.4013e-45) 27 9.4 >SB_5300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 74.1 bits (174), Expect = 8e-14 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAITPNV*PSCRRIFNLLDES 453 F+TD RFQSAAIGALQEA+EAYLVGLFEDTNLCAI C++ + LDES Sbjct: 76 FKTDLRFQSAAIGALQEAAEAYLVGLFEDTNLCAIHAKRVTLCQKTSSSLDES 128 >SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 29 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 63 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA*ISLI 424 L HAKRVTIMPKDIQLARRIRGERA +L+ Sbjct: 60 LCAIHAKRVTIMPKDIQLARRIRGERAMSTLV 91 >SB_35355| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 94 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 37 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 71 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 68 LCAIHAKRVTIMPKDIQLARRIRGERA 94 >SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 260 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 203 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 237 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 234 LCAIHAKRVTIMPKDIQLARRIRGERA 260 >SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 35.1 bits (77), Expect = 0.047 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLA 463 L HAKRVTIMPKDIQLA Sbjct: 110 LCAIHAKRVTIMPKDIQLA 128 >SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 205 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 148 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 182 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 179 LCAIHAKRVTIMPKDIQLARRIRGERA 205 >SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 131 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 74 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 108 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 105 LCAIHAKRVTIMPKDIQLARRIRGERA 131 >SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_32791| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 94 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 37 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 71 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 68 LCAIHAKRVTIMPKDIQLARRIRGERA 94 >SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) Length = 162 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQ 469 L HAKRVTIMPKDI+ Sbjct: 110 LCAIHAKRVTIMPKDIR 126 >SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) Length = 370 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 >SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113 >SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) Length = 136 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS A+ ALQEASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSLAVMALQEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) Length = 136 Score = 62.9 bits (146), Expect = 2e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ AL+EASEAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALKEASEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 62.9 bits (146), Expect = 2e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEA+EAYLVGLFEDTNLCAI Sbjct: 79 FKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAI 113 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 110 LCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) Length = 117 Score = 60.5 bits (140), Expect = 1e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 F+TD RFQS+A+ ALQEASEAYLVG EDTNLCAI Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGFIEDTNLCAI 113 >SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) Length = 110 Score = 56.0 bits (129), Expect = 2e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEASEAYLVGLFEDTN 519 F+TD RFQS+A+ ALQEASEAYLVGLFEDTN Sbjct: 79 FKTDLRFQSSAVMALQEASEAYLVGLFEDTN 109 >SB_47751| Best HMM Match : Histone (HMM E-Value=4.3e-07) Length = 55 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 29 LCAIHAKRVTIMPKDIQLARRIRGERA 55 Score = 37.5 bits (83), Expect = 0.009 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 554 EAYLVGLFEDTNLCAI 507 EAYLVGLFEDTNLCAI Sbjct: 17 EAYLVGLFEDTNLCAI 32 >SB_21745| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 20 LCAIHAKRVTIMPKDIQLARRIRGERA 46 Score = 48.0 bits (109), Expect = 6e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -2 Query: 572 ALQEASEAYLVGLFEDTNLCAI 507 ALQEASEAYLVGLFEDTNLCAI Sbjct: 2 ALQEASEAYLVGLFEDTNLCAI 23 >SB_11407| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 20 LCAIHAKRVTIMPKDIQLARRIRGERA 46 Score = 48.0 bits (109), Expect = 6e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -2 Query: 572 ALQEASEAYLVGLFEDTNLCAI 507 ALQEASEAYLVGLFEDTNLCAI Sbjct: 2 ALQEASEAYLVGLFEDTNLCAI 23 >SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07) Length = 407 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 381 LCAIHAKRVTIMPKDIQLARRIRGERA 407 Score = 33.1 bits (72), Expect = 0.19 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -2 Query: 566 QEASEAYLVGLFEDTNLCAI 507 Q+ ++ LVGLFEDTNLCAI Sbjct: 365 QQKAKKKLVGLFEDTNLCAI 384 >SB_27350| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRGERA 439 L HAKRVTIMPKDIQLARRIRGERA Sbjct: 20 LCAIHAKRVTIMPKDIQLARRIRGERA 46 Score = 48.0 bits (109), Expect = 6e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -2 Query: 572 ALQEASEAYLVGLFEDTNLCAI 507 ALQEASEAYLVGLFEDTNLCAI Sbjct: 2 ALQEASEAYLVGLFEDTNLCAI 23 >SB_10761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = -2 Query: 626 EKRSGFQTDWRFQSAAIGALQEASEAYLVGLFEDTNLCAI 507 E ++ D RF A+ ALQEA+EA++VG+F+D NLCAI Sbjct: 112 EISQNYRLDLRFHPDALLALQEATEAFIVGVFDDVNLCAI 151 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -1 Query: 519 LVCYHAKRVTIMPKDIQLARRIRG 448 L HAKRVTIMPKD+ LA RIRG Sbjct: 148 LCAIHAKRVTIMPKDLHLALRIRG 171 >SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEA 558 F+TD RFQS+A+ ALQEA Sbjct: 79 FKTDLRFQSSAVMALQEA 96 >SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) Length = 97 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 611 FQTDWRFQSAAIGALQEA 558 F+TD RFQS+A+ ALQEA Sbjct: 79 FKTDLRFQSSAVMALQEA 96 >SB_35943| Best HMM Match : MFS_1 (HMM E-Value=1.5e-05) Length = 514 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 142 NLQSHLTQIRHPWAFSVTNEPYTILHDHI 228 ++Q H + PWA + +EP T LHD++ Sbjct: 179 SIQDH-GNLPRPWALQLMDEPVTSLHDNV 206 >SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 668 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +1 Query: 250 LQILMKYIILILHCSIPLLE*KKISSAS 333 +Q+L+ Y++L ++C +PL K + S+S Sbjct: 584 IQVLLPYVLLKVYCGLPLRSVKPLRSSS 611 >SB_48360| Best HMM Match : EGF (HMM E-Value=0.1) Length = 594 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 547 ISLACSKTPTCVLSRQTC--DHHAEGYSTCSTNPW 449 + + CSKT TCVL + +C + H + N W Sbjct: 464 VCMRCSKTGTCVLRQDSCLINGHCFAQNDAKPNEW 498 >SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 28.7 bits (61), Expect = 4.1 Identities = 20/92 (21%), Positives = 47/92 (51%), Gaps = 3/92 (3%) Frame = +1 Query: 19 KSKLDLFNTKYSITHYESVQ---TQITHTHVWAWKYYLITTARHNLQSHLTQIRHPWAFS 189 KS +D F S+TH ++ T + K +T+A N+++ L ++RH ++ Sbjct: 396 KSTVDGFEILESVTHVGAISYSTTPVLEFRFNTLKGGKLTSA--NVKTLLNRVRHQRGYT 453 Query: 190 VTNEPYTILHDHILV*QEVQLQILMKYIILIL 285 ++ T+ + + ++ ++I +K ++L+L Sbjct: 454 FADKALTLANQQLFT-KKAGMRIAVKKVLLVL 484 >SB_31651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 827 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -2 Query: 584 AAIGALQEASEAYLVGLFEDTNLCAITP 501 A IG+++ +S AY+ GLF+ ++ ++P Sbjct: 130 AVIGSIESSSTAYVAGLFQVVDMPIVSP 157 >SB_33974| Best HMM Match : Coprogen_oxidas (HMM E-Value=0) Length = 539 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -3 Query: 598 GVSSLPPSELSRRQARLISLACSKTPTCVLSRQTCDHH 485 G +S S+LS R+ + + + P C+ R DHH Sbjct: 96 GSASRTSSQLSDRKPLFLHIIATPPPICIPGRSFPDHH 133 >SB_14248| Best HMM Match : AAA_5 (HMM E-Value=7.7e-14) Length = 1083 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 501 WRDSTQVGVFEQANEISLACLLESSDGGR 587 W D +GVF + +I+ C + GGR Sbjct: 698 WYDRKAIGVFRELVDITFVCAMGPPGGGR 726 >SB_23898| Best HMM Match : Ldl_recept_a (HMM E-Value=1.4013e-45) Length = 291 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 537 LVRRHQLVCYHAKRVTIMP 481 ++R H + CY KRVT+ P Sbjct: 23 IIRNHLIHCYQLKRVTVWP 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,168,684 Number of Sequences: 59808 Number of extensions: 312233 Number of successful extensions: 921 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 920 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -