BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0812 (588 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) 59 3e-09 SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) 49 2e-06 SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) 48 4e-06 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 48 6e-06 SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) 47 1e-05 SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) 47 1e-05 SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) 44 7e-05 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 44 1e-04 SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) 43 2e-04 SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38405| Best HMM Match : BACK (HMM E-Value=0) 43 2e-04 SB_18403| Best HMM Match : BACK (HMM E-Value=0) 43 2e-04 SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) 43 2e-04 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 42 4e-04 SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) 41 9e-04 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 40 0.002 SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23) 39 0.003 SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) 38 0.006 SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) 37 0.011 SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) 36 0.025 SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) 36 0.032 SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) 35 0.057 SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) 33 0.17 SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) 32 0.30 SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) 32 0.30 SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0) 30 1.6 SB_30888| Best HMM Match : CARDB (HMM E-Value=0.85) 30 1.6 SB_48929| Best HMM Match : BTB (HMM E-Value=1.4e-15) 29 2.8 SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 4.4 SB_45209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 645 Score = 58.8 bits (136), Expect = 3e-09 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 3/94 (3%) Frame = +1 Query: 184 GFHGLLSRGDLVDVTLAAEXI-IARHXLVLSVCSPYFQEMFKMN--PTQHPIVFLKDVSH 354 G + L R +L DV L + I+ H +VLS CS YF MF N ++ ++++K + Sbjct: 21 GLNQLRQRKELCDVELCVGNVQISAHRVVLSACSAYFDAMFTGNLLESKKQVIYIKGIDE 80 Query: 355 SALRDLLQFMYQGEVNVKQEELASFISTAEQLQV 456 +AL+ L+ F Y G+ + QE + + A LQ+ Sbjct: 81 TALQLLVDFAYTGKAEITQENVQLLLPAANMLQL 114 >SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 651 Score = 49.2 bits (112), Expect = 2e-06 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 3/117 (2%) Frame = +1 Query: 124 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAA-EXIIARHXLVLSVCSPYFQEM 300 MAS++ C +F + + + L S L DVTL + + H +VL+ SPYF M Sbjct: 1 MASEDGLLFCVPDFPTKVFSSLNELRSEEKLCDVTLVVKDRSLVSHRVVLAGWSPYFHAM 60 Query: 301 F--KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 465 M ++ V + + +AL +L+ F Y G + E + S + + LQ+ + Sbjct: 61 LTGDMLESRLEKVTIHGIECAALEELINFCYTGRTEIHVENVQSLMCASSLLQLSNV 117 >SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 48.4 bits (110), Expect = 4e-06 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 3/83 (3%) Frame = +1 Query: 214 LVDVTLAA-EXIIARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 384 L DV L E A H VL+ CS YF MF ++ ++ I+ +KD+ ++ L++F Sbjct: 11 LCDVVLRIDEQSYAGHRAVLASCSAYFYAMFNGELAESKQKIITMKDILPDYMQVLVEFA 70 Query: 385 YQGEVNVKQEELASFISTAEQLQ 453 Y G V + E + + ++TA LQ Sbjct: 71 YTGRVEITVENVQNLLATASLLQ 93 >SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) Length = 635 Score = 48.4 bits (110), Expect = 4e-06 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +1 Query: 214 LVDVTLAAEXI-IARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 384 L DV L E + + H LVL+ SP+F +F +M Q + LK V S + ++L+++ Sbjct: 33 LCDVDLMVEGLTFSAHRLVLAAGSPFFHGLFTTEMKEKQENKIVLKQVKASVMENVLEYL 92 Query: 385 YQGEVNVKQEELASFISTAEQLQVKGL 465 Y G+ ++ E + +A ++GL Sbjct: 93 YTGKTSLNPENAEDLVVSASYFLIEGL 119 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 48.0 bits (109), Expect = 6e-06 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 3/85 (3%) Frame = +1 Query: 211 DLVDVTL-AAEXIIARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQF 381 +L DV + I H +VL+ CSPYF+ MF +M ++ + ++DV SA+ L+ F Sbjct: 57 ELCDVVIKVGSSTIHAHRVVLAACSPYFRAMFTREMAESRQAEITIRDVDESAMNLLITF 116 Query: 382 MYQGEVNVKQEELASFISTAEQLQV 456 Y + +++ + + + A LQ+ Sbjct: 117 AYTASITIEETNVQTLLPAACLLQL 141 >SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 481 Score = 47.2 bits (107), Expect = 1e-05 Identities = 35/112 (31%), Positives = 50/112 (44%), Gaps = 3/112 (2%) Frame = +1 Query: 196 LLSRGDLVDVTLAA-EXIIARHXLVLSVCSPYFQEMFKMNPTQ--HPIVFLKDVSHSALR 366 L R L DVTL E I H LVL+ S YFQ MF + V L+DV A+ Sbjct: 40 LRGRKQLCDVTLCVGERQIVAHRLVLASFSSYFQAMFTGGLVESFEDSVTLRDVDSGAVE 99 Query: 367 DLLQFMYQGEVNVKQEELASFISTAEQLQVKGLTGNQNEESSTPSKPSRLRG 522 L+ F Y G++++ E + S + + Q+ + +E PS G Sbjct: 100 LLVDFAYTGKLDITTENVQSIMYASSLFQLNAIQKACSEFLERQLHPSNCLG 151 >SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 625 Score = 47.2 bits (107), Expect = 1e-05 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 3/90 (3%) Frame = +1 Query: 196 LLSRGDLVDVTL-AAEXIIARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALR 366 LL + L DVT+ A E I H +VL+ CS YF MF M + ++ ++ +S ++ Sbjct: 27 LLEQEKLCDVTIKAGERKIRCHRVVLASCSAYFHSMFTNSMLESSQEVITIQGLSEKSVI 86 Query: 367 DLLQFMYQGEVNVKQEELASFISTAEQLQV 456 L+ FMY ++ + + + S ++ + Q+ Sbjct: 87 QLINFMYTRKITITIDNIESLLTASAVFQL 116 >SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 581 Score = 46.4 bits (105), Expect = 2e-05 Identities = 29/94 (30%), Positives = 49/94 (52%), Gaps = 4/94 (4%) Frame = +1 Query: 187 FHGLLSRGDLVDVTLAAEXI-IARHXLVLSVCSPYFQEMFKMN---PTQHPIVFLKDVSH 354 F+ + +L DV L + I H LVL+ SPYF+ MF N TQ I L D+ Sbjct: 23 FNDFRNSKELCDVLLCVDDEEIPSHKLVLAASSPYFRAMFTSNLLECTQRTIT-LYDIDV 81 Query: 355 SALRDLLQFMYQGEVNVKQEELASFISTAEQLQV 456 AL+ ++++ Y G++ + ++ + + + LQV Sbjct: 82 GALQQIVEYFYTGKITIDEDNVQFLLHASCLLQV 115 >SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 587 Score = 44.4 bits (100), Expect = 7e-05 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 3/89 (3%) Frame = +1 Query: 214 LVDVTLAAEXI-IARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 384 L DVTL E H +VL+ S YF +F +M P V L+++ S + +L ++ Sbjct: 29 LCDVTLVVEGKEFPAHRIVLAASSKYFYGLFTSEMIEKNAPSVKLQELRASVMNHILTYL 88 Query: 385 YQGEVNVKQEELASFISTAEQLQVKGLTG 471 Y GE+ V + I++A L + L G Sbjct: 89 YTGEITVTELNAEDLIASANYLLIPRLKG 117 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 43.6 bits (98), Expect = 1e-04 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 4/86 (4%) Frame = +1 Query: 208 GDLVDVTLAAEX--IIARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLL 375 G DV L E I H LVLS S YF+ MF M +Q + ++ + ++ L+ Sbjct: 23 GIFCDVVLMTEDGQEIDAHKLVLSASSEYFRAMFLTDMKESQQKFITIRAIDSQSMTTLV 82 Query: 376 QFMYQGEVNVKQEELASFISTAEQLQ 453 +F Y V + E + + + A LQ Sbjct: 83 EFAYTSNVRINSENVETLLYAASMLQ 108 >SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) Length = 518 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 3/96 (3%) Frame = +1 Query: 187 FHGLLSRGDLVDVTLAAEXI-IARHXLVLSVCSPYFQEMFKMN--PTQHPIVFLKDVSHS 357 F L G+L+DVTL + I H +VL+ CSPYF+ M T + L + Sbjct: 29 FKELRDDGELLDVTLHVQGEEIKAHRVVLAACSPYFRAMLTTGFAETFMSTIPLHECDPV 88 Query: 358 ALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 465 ++ ++++ Y + + +E + +S A ++ + Sbjct: 89 GVQSIVEYFYSKRLTITKENIEGLLSAASLFEIPSI 124 >SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 43.2 bits (97), Expect = 2e-04 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 3/115 (2%) Frame = +1 Query: 187 FHGLLSRGDLVDVTLA-AEXIIARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHS 357 F L D+ + + I H LVL+ S YF MF M T V L D+ + Sbjct: 24 FEDFRKNSQLCDIKIVIGDKRIRAHKLVLASFSDYFSAMFTGDMAETSQNTVHLTDMDPA 83 Query: 358 ALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGLTGNQNEESSTPSKPSRLRG 522 A++ L+ + Y E+ ++ + + + +S A LQ+ + +E PS G Sbjct: 84 AVQALISYSYTSEIEIRVDNVENLLSVACILQIDEVKNACSEFMRHQLHPSNCLG 138 >SB_38405| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 3/88 (3%) Frame = +1 Query: 211 DLVDVTL-AAEXIIARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQF 381 +L DV L + I H LVL+ CS YF MF ++ ++ + L+ + A+ L++F Sbjct: 40 ELCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEF 99 Query: 382 MYQGEVNVKQEELASFISTAEQLQVKGL 465 Y + V ++ + + + A LQ++ + Sbjct: 100 AYTARIQVSEDNVQALLPAASLLQLESV 127 >SB_18403| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 3/88 (3%) Frame = +1 Query: 211 DLVDVTL-AAEXIIARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQF 381 +L DV L + I H LVL+ CS YF MF ++ ++ + L+ + A+ L++F Sbjct: 40 ELCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEF 99 Query: 382 MYQGEVNVKQEELASFISTAEQLQVKGL 465 Y + V ++ + + + A LQ++ + Sbjct: 100 AYTARIQVSEDNVQALLPAASLLQLESV 127 >SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) Length = 521 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 2/69 (2%) Frame = +1 Query: 256 HXLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASF 429 H +V+S SPYF+ +F + + V ++ + LL F+Y G +NV +E + Sbjct: 48 HKIVVSASSPYFEVLFSGGLRESYLDTVTIQGIDSETFSALLDFIYTGVINVNEENVQQL 107 Query: 430 ISTAEQLQV 456 + A+ LQ+ Sbjct: 108 LPAAKMLQL 116 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 41.9 bits (94), Expect = 4e-04 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 3/114 (2%) Frame = +1 Query: 133 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEXI-IARHXLVLSVCSPYFQEMFK- 306 D+ F+ + + + + L G + DV + AE H +LS S YF MF Sbjct: 6 DDSFTFYDDKYSKAILHRINQLRHHGAMCDVVIKAEDTEFLAHRNILSASSDYFFAMFNG 65 Query: 307 -MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 465 M + +V + V+ ++R +L F+Y GE+ + + + + A + V+ + Sbjct: 66 NMKESSQDVVTITGVTPDSMRSILNFIYTGEIVLDWDNVELILQGANLMLVQSV 119 >SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 40.7 bits (91), Expect = 9e-04 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 3/82 (3%) Frame = +1 Query: 214 LVDVTLAA-EXIIARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 384 L DVTL E + H +L+ SPYF+ +F +M Q + L +V + D+L ++ Sbjct: 25 LCDVTLNVNEVLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYL 84 Query: 385 YQGEVNVKQEELASFISTAEQL 450 Y G V V++ + A+ + Sbjct: 85 YSGSVVVEESKAIPLTVAADYM 106 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +1 Query: 214 LVDVTLAA-EXIIARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQFM 384 L DVTL E + H +L+ SPYF+ +F +M Q + L +V + D+L ++ Sbjct: 1394 LCDVTLNVNEVLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYL 1453 Query: 385 YQGEVNVKQ 411 Y G V V++ Sbjct: 1454 YSGSVVVEE 1462 >SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23) Length = 417 Score = 39.1 bits (87), Expect = 0.003 Identities = 30/92 (32%), Positives = 43/92 (46%), Gaps = 2/92 (2%) Frame = +1 Query: 196 LLSRGDLVDVTLAAEXI-IARHXLVLSVCSPYFQEMFKMNPTQHP-IVFLKDVSHSALRD 369 +LS + V T A E I I H VLSV SP F+ MF + + L D AL + Sbjct: 25 VLSDVEFVVCTSAGEKISIPAHRYVLSVSSPVFEAMFHGAMAESSREISLPDCYAEALSE 84 Query: 370 LLQFMYQGEVNVKQEELASFISTAEQLQVKGL 465 +L++ Y EV + + + AE+ GL Sbjct: 85 MLRYAYYDEVKLTGSNAMAVMYLAEKYNFPGL 116 >SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) Length = 603 Score = 37.9 bits (84), Expect = 0.006 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 3/80 (3%) Frame = +1 Query: 220 DVTLAAEX-IIARHXLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQ 390 DV L E + A H VL+ S +F MF M + + L ++ AL +L F Y Sbjct: 53 DVNLEVEGQVFAAHRCVLAANSQFFYTMFTSGMRDSNDSRIKLCSLTSGALSSILDFFYT 112 Query: 391 GEVNVKQEELASFISTAEQL 450 E+N+ ++ + + A L Sbjct: 113 REINISRDNVVDILEAASFL 132 >SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2201 Score = 37.5 bits (83), Expect = 0.008 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 3/87 (3%) Frame = +1 Query: 214 LVDVTL--AAEXIIARHXLVLSVCSPYFQEMFKMNPTQHPIVFLK-DVSHSALRDLLQFM 384 + D+TL +E I H +VL+ S YF+ +F + + D+S L+ +L+++ Sbjct: 28 MCDITLKTTSEDIFPAHKIVLAAKSDYFKALFTTEMAEKNCQEISLDISTRTLKAILKYV 87 Query: 385 YQGEVNVKQEELASFISTAEQLQVKGL 465 Y G+V++ S A+ L + L Sbjct: 88 YCGDVSLNVSNARSVFVAADYLMMDHL 114 >SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) Length = 123 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Frame = +1 Query: 220 DVTL-AAEXIIARHXLVLSVCSPYFQEMF---KMNPTQHPIVFLKDVSHSALRDLLQFMY 387 D+TL A +++ H +VL+ SPYF+E+ + V + A+ +L+F Y Sbjct: 42 DITLKAGNLVLSAHRVVLAALSPYFRELLLPTNNEKAEKEYVMPDSLKPGAVVAMLEFFY 101 Query: 388 QGEVNVKQEELASFISTAEQLQ 453 G + + + + ++ A ++ Sbjct: 102 SGTLQINLKSIEDLLAAASTMK 123 >SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 35.9 bits (79), Expect = 0.025 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 3/69 (4%) Frame = +1 Query: 208 GDLVDVTLAAEXI-IARHXLVLSVCSPYFQEMF--KMNPTQHPIVFLKDVSHSALRDLLQ 378 G L DV L E H +VL+ CS YF MF M +Q ++ L+ ++ + LL Sbjct: 35 GKLCDVVLQVEKKEFPAHRIVLASCSDYFYAMFTNDMLESQKGVIELQGLASDTMEVLLD 94 Query: 379 FMYQGEVNV 405 F+Y V + Sbjct: 95 FVYTETVKL 103 >SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 595 Score = 35.9 bits (79), Expect = 0.025 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +1 Query: 214 LVDVTLAAEXI-IARHXLVLSVCSPYFQEMFKMN-PTQHPIVFLKDVSHSALRDLLQFMY 387 L DV L + H +L+ S YF MF + T V +++++ +A+ LL F+Y Sbjct: 33 LTDVVLIVDGHEFPAHKNILAASSDYFMAMFSGHMATVDRTVVVQEITSTAMEVLLAFIY 92 Query: 388 QGEVNVKQEEL 420 QG++ + +E + Sbjct: 93 QGKLLITEENV 103 >SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 35.5 bits (78), Expect = 0.032 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 3/82 (3%) Frame = +1 Query: 214 LVDVTL-AAEXIIARHXLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFM 384 L DV L A H VL S +F +F M Q V LK + + DLL ++ Sbjct: 20 LCDVELIVGNNRFAAHKNVLCASSIFFNGLFSSSMRERQENTVNLKQFPVNIMEDLLTYL 79 Query: 385 YQGEVNVKQEELASFISTAEQL 450 Y G++ V + F++ A+ L Sbjct: 80 YTGKLEVTEATAQDFLAAADFL 101 >SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) Length = 467 Score = 34.7 bits (76), Expect = 0.057 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 256 HXLVLSVCSPYFQEMFKMNPTQH-PIVFLKDVSHSALRDLLQFMYQGEV 399 H VLSV SP F+ MF N + P V L D + ++LL+++Y +V Sbjct: 46 HKFVLSVSSPVFEAMFFGNLAESGPTVRLPDCTVDGFQELLRYLYCDQV 94 >SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) Length = 176 Score = 33.1 bits (72), Expect = 0.17 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 4/88 (4%) Frame = +1 Query: 208 GDLVDVTL-AAEXIIARHXLVLSVCSPYFQEMFK---MNPTQHPIVFLKDVSHSALRDLL 375 G+ DVTL + H LVL+ S YF+ MF + +++ +V L D+ + ++ Sbjct: 30 GEGCDVTLKVTDQSFPGHKLVLAANSTYFRAMFGEGFVESSKNDVV-LHDLDPKGVNAVI 88 Query: 376 QFMYQGEVNVKQEELASFISTAEQLQVK 459 + Y ++ + + + + A VK Sbjct: 89 SYFYNSKIEINADNFGAVFAVANMWDVK 116 >SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) Length = 259 Score = 32.3 bits (70), Expect = 0.30 Identities = 18/71 (25%), Positives = 35/71 (49%) Frame = +1 Query: 256 HXLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFIS 435 H LS+ SP F++MF+ Q + L ++++L +Y V +E ++ Sbjct: 31 HKSTLSMWSPVFEKMFRERNDQE--ICLPGKKSKEIKEMLLVIYPTSKKVTEENCYYLLT 88 Query: 436 TAEQLQVKGLT 468 A++ Q++ LT Sbjct: 89 LAQEYQMEQLT 99 >SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) Length = 619 Score = 32.3 bits (70), Expect = 0.30 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 5/89 (5%) Frame = +1 Query: 208 GDLVDVTL-AAEXIIARHXLVLSVCSPYFQEMFKMN----PTQHPIVFLKDVSHSALRDL 372 G+ DVTL + H LVL+ S YF+ MF + + V L D+ + + Sbjct: 72 GEGCDVTLKVTDQSFPGHKLVLAANSTYFRAMFGLREGFVESSKNDVVLHDLDPKGVNAV 131 Query: 373 LQFMYQGEVNVKQEELASFISTAEQLQVK 459 + + Y ++ + + + + A VK Sbjct: 132 ISYFYNSKIEINADNFEAVFAVANMWDVK 160 >SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 628 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/53 (20%), Positives = 30/53 (56%) Frame = +1 Query: 307 MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 465 M+ ++ V L+++ A+++++ F Y G++ + + + + A LQV+ + Sbjct: 66 MSESRQDTVTLQELDEKAMQNMIDFFYSGKIEISELNVQEVLPIACLLQVQSV 118 >SB_30888| Best HMM Match : CARDB (HMM E-Value=0.85) Length = 299 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 391 GEVNVKQEELASFISTAEQLQVKGLTGN-QNEESSTPSKPSRLRGQAPGR 537 G+VNV + S+ +Q K Q + STP+ +RLRG +PGR Sbjct: 79 GQVNVDLNQELSWPQYPGAVQYKIFIWKYQTPQPSTPTATTRLRGYSPGR 128 >SB_48929| Best HMM Match : BTB (HMM E-Value=1.4e-15) Length = 239 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = +1 Query: 256 HXLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVN--VKQEELASF 429 H +L + SP F+ MF+ PI L + + DL+ +Y N + + + Sbjct: 32 HKFILKMASPVFKAMFEHVKDSKPIQ-LPGKKFNQVLDLMNHIYPTSNNSSITMDNVEHL 90 Query: 430 ISTAEQLQVKGLTGN 474 + A + Q+K +T + Sbjct: 91 SALAAEYQIKAVTNS 105 >SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 23.8 bits (49), Expect(2) = 4.4 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = +1 Query: 256 HXLVLSVCSPYFQEMF----KMN--PTQHPIVFLKDVSHS 357 H +LS SP F+E+F K+N P ++ +F D+S S Sbjct: 266 HQTILSAASPIFRELFLGSKKVNAVPRKYQAIF-SDISWS 304 Score = 23.0 bits (47), Expect(2) = 4.4 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +1 Query: 343 DVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVK 459 D+S + +LQF+Y G + E + F+ ++ K Sbjct: 329 DISCESFEKILQFLYTGLPGFSEIEDSDFVLDVKKTAAK 367 >SB_45209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 995 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 124 MASDEQFSLCWNNFHANMSAGFHGL 198 M S E WN F N++AG+H L Sbjct: 203 MMSYEGMQFDWNTFSVNLTAGYHQL 227 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,094,421 Number of Sequences: 59808 Number of extensions: 315404 Number of successful extensions: 747 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -