BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0808 (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 2.7 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 6.3 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 6.3 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 23 8.4 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 2.7 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +1 Query: 85 CPKNTEHRA-RHAGKCACCPACVTLLGEGA 171 C + E++ RH G C CPAC L+ + A Sbjct: 1016 CDRCKENKYDRHQG-CLDCPACYNLVQDAA 1044 Score = 22.6 bits (46), Expect = 8.4 Identities = 18/68 (26%), Positives = 25/68 (36%) Frame = +1 Query: 37 GTDYCEKNPCIQXPLVCPKNTEHRARHAGKCACCPACVTLLGEGATCEIYSXXLXXTPSA 216 G +C+ N + C KN C C C + A+C+ YS P Sbjct: 907 GNCHCKPNVIGRTCNEC-KNGYWNIVSGNGCESCN-CDPIGSYNASCDTYSGDCFCKPGV 964 Query: 217 VCKEPLKC 240 V K+ KC Sbjct: 965 VGKKCDKC 972 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.0 bits (47), Expect = 6.3 Identities = 6/19 (31%), Positives = 14/19 (73%) Frame = -1 Query: 267 HKLSETLFDAFERLLTHSG 211 H+++E + D + ++L H+G Sbjct: 1347 HRIAELIADKYHKILRHAG 1365 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 402 FFSPKCLXFTTVHIXINF 349 F SP CL ++V + INF Sbjct: 38 FVSPSCLECSSVPLFINF 55 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 22.6 bits (46), Expect = 8.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 118 AGKCACCPACVTLLGEG 168 AG +CCPA L G G Sbjct: 19 AGTSSCCPAGTGLNGSG 35 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 480,225 Number of Sequences: 2352 Number of extensions: 8682 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -