BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0808 (528 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11620.1 68418.m01359 SWIM zinc finger family protein / mitog... 29 2.6 At1g78860.1 68414.m09192 curculin-like (mannose-binding) lectin ... 27 5.9 At5g15660.1 68418.m01832 F-box family protein contains Pfam PF00... 27 7.8 >At5g11620.1 68418.m01359 SWIM zinc finger family protein / mitogen-activated protein kinase kinase kinase (MAPKKK)-related contains weak similarity to Swiss-Prot:P53349 mitogen-activated protein kinase kinase kinase 1 (MAPK/ERK kinase kinase 1, MEK kinase 1, MEKK 1) [Mus musculus]; contains Pfam profile PF04434: SWIM zinc finger Length = 273 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 166 GATCEIYSXXLXXTPSAVCKEPLKCIKQSFTKLV 267 GATC +Y+ L TP+ C + K K L+ Sbjct: 53 GATCNVYTVTLMATPTCTCPDRKKPCKHILFVLI 86 >At1g78860.1 68414.m09192 curculin-like (mannose-binding) lectin family protein low similarity to Ser/Thr protein kinase [Zea mays] GI:2598067; contains Pfam profile PF01453: Lectin (probable mannose binding) Length = 443 Score = 27.5 bits (58), Expect = 5.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 121 GKCACCPACVTLLGEGATCEIYS 189 G+C CP+ + LLG TC+I S Sbjct: 330 GQCNACPSDIGLLGWDETCKIPS 352 >At5g15660.1 68418.m01832 F-box family protein contains Pfam PF00646: F-box domain Length = 438 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -2 Query: 263 SLVKLCLMHLRGSLHTAEG 207 SL++L +H+RGS HTA G Sbjct: 383 SLLRLDNLHIRGSTHTATG 401 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,106,611 Number of Sequences: 28952 Number of extensions: 142479 Number of successful extensions: 289 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 289 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -