BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0805 (449 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 1.8 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 2.3 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 7.1 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.6 bits (46), Expect = 1.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 126 PHGSTFRLXADSGRFSQCCSRTPCEQR 206 P+G T + D G + CS PCE + Sbjct: 88 PYGYTGK---DCGEYVDWCSTNPCENQ 111 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.2 bits (45), Expect = 2.3 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = +1 Query: 274 KDKFQVXLDVQHFAPEEISVXTADGYIVVEGKHEDKXDQHGYISRQFTRRYA 429 KD ++ D++ P+ + + G V G+ E+K ++ + TRR A Sbjct: 83 KDNYRKVTDLKKRFPKLKVLLSVGGNADVSGQDEEKNIKYRNLLETTTRRLA 134 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 20.6 bits (41), Expect = 7.1 Identities = 6/24 (25%), Positives = 12/24 (50%) Frame = -1 Query: 329 EISSGAKCWTSRXTWNLSLSILML 258 ++ S +CW TW + I ++ Sbjct: 187 QVQSMPQCWIDLQTWQWKVYITLV 210 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,729 Number of Sequences: 336 Number of extensions: 1583 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -