BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0801 (568 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pomb... 28 0.83 SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc... 27 1.5 SPBC30D10.05c |||sepiapterin reductase |Schizosaccharomyces pomb... 25 5.9 SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomy... 25 5.9 >SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 28.3 bits (60), Expect = 0.83 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 287 PLQPREQLAVHDAMAXARQQLQATELSXAALARCIES 397 P+ EQL VHD + L+++E A RC+ S Sbjct: 1760 PILDSEQLVVHDFLEELFSSLKSSEEDFALRTRCVTS 1796 >SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1576 Score = 27.5 bits (58), Expect = 1.5 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 113 LAAAVICPSDEDSKTFTINCASGDMLKLRATDARARQEW 229 L + I S ED+ ++C S M KLR+T + W Sbjct: 1489 LVQSAIRESSEDAIALAVDCDSEAMEKLRSTTTLDEESW 1527 >SPBC30D10.05c |||sepiapterin reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 247 Score = 25.4 bits (53), Expect = 5.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 163 GEGLGVFVAWAYHCCS 116 G + VF AWA +CCS Sbjct: 138 GAAVRVFPAWAAYCCS 153 >SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 543 Score = 25.4 bits (53), Expect = 5.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 128 ICPSDEDSKTFTINCASGDML 190 +CPS S F++NC +G M+ Sbjct: 62 LCPSLVGSMAFSMNCGAGGMV 82 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,784,607 Number of Sequences: 5004 Number of extensions: 29371 Number of successful extensions: 89 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -