BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0795 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0234 - 26602660-26602728,26602814-26602988,26603077-266031... 51 8e-07 06_01_0356 + 2557127-2557193,2557272-2557315,2557433-2557528,255... 48 4e-06 01_06_0465 - 29573972-29574110,29574300-29574343,29574434-295746... 45 5e-05 06_03_0740 - 24006485-24006629,24006821-24006864,24006954-240071... 38 0.006 07_03_1756 - 29239137-29239325,29239741-29240259,29240693-292408... 31 0.70 04_04_1509 - 34074206-34074398,34074506-34074777,34075411-340756... 29 2.8 05_05_0163 + 22842955-22844371,22845519-22845592,22845913-22845948 29 3.7 12_01_0109 + 853043-853426,853653-853787,853866-854138 28 4.9 04_04_0122 - 22918146-22918220,22918455-22918496,22918586-229186... 28 4.9 09_06_0262 - 21921647-21922796,21922897-21923423 27 8.6 >05_06_0234 - 26602660-26602728,26602814-26602988,26603077-26603120, 26603204-26603381,26603468-26603652,26603737-26603801, 26603985-26604066,26604342-26604434,26605096-26605191, 26605312-26605355,26605467-26605530 Length = 364 Score = 50.8 bits (116), Expect = 8e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = +2 Query: 266 DIEAKFYSEVHALECKYGKLYKPLYEKRALIVNGTYE 376 D+EAKF+ E ALE KY K+Y+PLY KR IVNG E Sbjct: 73 DLEAKFFEERAALEAKYQKMYEPLYSKRYEIVNGVVE 109 Score = 31.5 bits (68), Expect = 0.53 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 520 KGXPDFWYNIFRDVSMLSEMMQEXD 594 KG P+FW N ++ +LSE +QE D Sbjct: 129 KGVPEFWLNAMKNHEILSEEIQERD 153 >06_01_0356 + 2557127-2557193,2557272-2557315,2557433-2557528, 2559259-2559351,2559450-2559540,2559617-2559678, 2559754-2559938,2560022-2560199,2560293-2560336, 2560440-2560635,2560728-2560745,2560955-2561005 Length = 374 Score = 48.4 bits (110), Expect = 4e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 266 DIEAKFYSEVHALECKYGKLYKPLYEKRALIVNGTYE 376 +IE KF+ E ALE KY KLY+PLY KR IVNG E Sbjct: 74 EIELKFFEERAALEAKYQKLYEPLYTKRYNIVNGVVE 110 Score = 32.3 bits (70), Expect = 0.30 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 508 DPNVKGXPDFWYNIFRDVSMLSEMMQEXD 594 D + KG PDFW + +LSE +QE D Sbjct: 128 DADAKGVPDFWLTAMKTNEVLSEEIQERD 156 >01_06_0465 - 29573972-29574110,29574300-29574343,29574434-29574602, 29574707-29574894,29575081-29575145,29575257-29575311, 29575502-29575594,29576035-29576130,29576259-29576302, 29576419-29576431 Length = 301 Score = 44.8 bits (101), Expect = 5e-05 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +2 Query: 266 DIEAKFYSEVHALECKYGKLYKPLYEKRALIVNGTYE 376 ++EAKF E ALE Y KLY PLY KR+ IV+G E Sbjct: 56 ELEAKFLEEKAALEANYQKLYGPLYSKRSEIVSGVLE 92 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 520 KGXPDFWYNIFRDVSMLSEMMQEXD 594 KG PDFW ++ +L+E + E D Sbjct: 103 KGVPDFWLKAMKNNEILAEEIHESD 127 >06_03_0740 - 24006485-24006629,24006821-24006864,24006954-24007122, 24007226-24007413,24007572-24007634,24007992-24008084, 24009837-24009932,24010024-24010067,24010184-24010357, 24010764-24010974 Length = 408 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +2 Query: 266 DIEAKFYSEVHALECKYGKLYKPLYEK 346 ++E KF+ E ALE KY KLY PLY K Sbjct: 180 ELEVKFFEEKAALEAKYQKLYGPLYSK 206 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 520 KGXPDFWYNIFRDVSMLSEMMQEXD 594 KG PDFW N ++ +L+E + E D Sbjct: 208 KGVPDFWLNAMKNNEILAEEIHESD 232 >07_03_1756 - 29239137-29239325,29239741-29240259,29240693-29240800, 29240856-29241155,29241730-29241831,29243042-29243209, 29243878-29243991,29244184-29244288,29244372-29244502, 29244794-29244918,29245001-29245172,29245277-29245316, 29245636-29245722,29245803-29245868,29246412-29246510, 29246714-29246836,29247066-29247107,29247195-29247260, 29247362-29247553,29247672-29247737,29248839-29249141 Length = 1038 Score = 31.1 bits (67), Expect = 0.70 Identities = 20/65 (30%), Positives = 32/65 (49%) Frame = +2 Query: 278 KFYSEVHALECKYGKLYKPLYEKRALIVNGTYEPNDDECLNPWRDDTXEEELARAVQNAA 457 K Y ++ + G +P E A IV + EPN + N +D+T E+ A +NAA Sbjct: 663 KIYRKIALQLVRQGVSNEPTQE--AAIVTASEEPNGGDSANKLKDETMEDP---ATENAA 717 Query: 458 ITEGE 472 +T + Sbjct: 718 MTNAD 722 >04_04_1509 - 34074206-34074398,34074506-34074777,34075411-34075608, 34076092-34076187,34076318-34076500,34076597-34076799, 34076887-34077013,34077098-34077292,34077400-34077540, 34077669-34077812,34077876-34078040,34078776-34078976, 34079049-34079195,34079275-34079427,34079731-34079833, 34079954-34080069,34080168-34080349,34080442-34080541, 34081200-34081527,34081605-34081834,34081979-34082110, 34082787-34082859,34083274-34083338 Length = 1248 Score = 29.1 bits (62), Expect = 2.8 Identities = 20/88 (22%), Positives = 42/88 (47%), Gaps = 4/88 (4%) Frame = +2 Query: 239 LENSSEEFVDIEAKFYSEVHALECKYGKL--YKPLYEKRALIV--NGTYEPNDDECLNPW 406 LEN ++ + ++Y+ + ++ K +PL +K + N P++ +PW Sbjct: 848 LENLYKQEQVLRKRYYNTIEDMKGKIRVFCRLRPLNDKELIEKDKNIVCSPDEFTVAHPW 907 Query: 407 RDDTXEEELARAVQNAAITEGEXKKDDK 490 +DD ++ + V +A T+ E +D K Sbjct: 908 KDDKSKQHIYDRVFDANTTQEEVFEDTK 935 >05_05_0163 + 22842955-22844371,22845519-22845592,22845913-22845948 Length = 508 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = -1 Query: 415 VITPWVETFIIIRFICAIHNKSSLFIKRLVKFPIFAFECMYFTVKLGLNVD 263 V+ PW+++F I + +H+K +L K +K A + + +K G+ +D Sbjct: 459 VLPPWLDSFPIPNAVLCLHSKINLSGKNNMKNETLA-DILVINIKTGILMD 508 >12_01_0109 + 853043-853426,853653-853787,853866-854138 Length = 263 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 207 GMPSLLHEGDL*WPLSFHYGSRHFSTGVALVHHFXXXXXXLQTP 76 G+P L GD+ + L+F G+ H T VAL F Q+P Sbjct: 129 GVPDLSEHGDV-YDLTFGLGADHPPTAVALRKEFQRIILYQQSP 171 >04_04_0122 - 22918146-22918220,22918455-22918496,22918586-22918642, 22918784-22918844,22919219-22919280,22919372-22919485, 22919565-22919636,22919824-22919874,22919990-22920112, 22921261-22921383 Length = 259 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 517 VKGXPDFWYNIFRDVSMLSEMMQEXD 594 +K PDFW F ML E++ E D Sbjct: 72 IKQIPDFWLTAFLSHPMLGELLTEDD 97 >09_06_0262 - 21921647-21922796,21922897-21923423 Length = 558 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +2 Query: 392 CLNPWRDDTXEEELARAVQNAAITEGEXKKDDKAIEPPMIPM*R 523 CL+PW D E V +AA GE D + E M + R Sbjct: 300 CLSPWSDHRSSEYYNCNVYDAAKANGEASDDKRRREQGMASLDR 343 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,552,824 Number of Sequences: 37544 Number of extensions: 269327 Number of successful extensions: 622 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -