BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0795 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 2.3 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 4.0 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 5.3 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 9.2 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 308 IRVHVLHCKTWPQCRQTPLKSSQGADSPTNIRG*GCH 198 ++ HVL T P+ + TP ++ NIR CH Sbjct: 391 VQTHVLTIHTIPEVKVTPRFQAKRLKEEANIR---CH 424 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 Query: 371 YEPNDDECLNPWRDDTXEEELARAVQNAAITEG 469 ++P D+EC E R N+ IT G Sbjct: 199 WQPEDEECTEATAGAVVLETCQRNSNNSTITAG 231 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 389 ECLNPWRDDTXEEELA 436 + L W DD+ EEEL+ Sbjct: 34 QMLGIWADDSDEEELS 49 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -1 Query: 412 ITPWVETFIIIRFICAIHN 356 ITP ++ + I C +HN Sbjct: 315 ITPLIQKHLKIHDTCGVHN 333 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,730 Number of Sequences: 438 Number of extensions: 2509 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -