BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0793 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30600.2 68415.m03729 BTB/POZ domain-containing protein conta... 44 1e-04 At2g30600.1 68415.m03728 BTB/POZ domain-containing protein conta... 44 1e-04 At1g01640.2 68414.m00082 speckle-type POZ protein-related contai... 40 0.001 At1g01640.1 68414.m00081 speckle-type POZ protein-related contai... 40 0.001 At4g08455.1 68417.m01394 BTB/POZ domain-containing protein Inter... 39 0.003 At5g21010.1 68418.m02497 speckle-type POZ protein-related contai... 33 0.14 At3g43700.1 68416.m04664 speckle-type POZ protein-related contai... 31 0.77 At5g48510.1 68418.m05998 speckle-type POZ protein-related contai... 29 3.1 At4g04090.1 68417.m00578 speckle-type POZ protein-related contai... 29 3.1 At5g45110.1 68418.m05536 ankyrin repeat family protein / BTB/POZ... 28 5.4 At2g40440.1 68415.m04990 BTB/POZ domain-containing protein conta... 27 9.5 >At2g30600.2 68415.m03729 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/54 (37%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = +2 Query: 254 THKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVK 409 +HK++LS+ S F +MF M+ + ++L DVS A + ++ FMY GE+N++ Sbjct: 366 SHKVILSLWSVAFAKMFTNGMSESHSSTIYLTDVSPEAFKAMMNFMYSGELNME 419 Score = 32.7 bits (71), Expect = 0.19 Identities = 17/70 (24%), Positives = 33/70 (47%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELAS 427 + HK++L F + + ++ L+ VS+ L LLQ++Y G + + ELA Sbjct: 224 VPAHKVILQASGN-----FPLRSSDGDVIQLRGVSYPILHALLQYIYTGRTQILESELAP 278 Query: 428 FISTAEQLQV 457 + + +V Sbjct: 279 LRDLSSKFEV 288 >At2g30600.1 68415.m03728 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/54 (37%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = +2 Query: 254 THKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVK 409 +HK++LS+ S F +MF M+ + ++L DVS A + ++ FMY GE+N++ Sbjct: 366 SHKVILSLWSVAFAKMFTNGMSESHSSTIYLTDVSPEAFKAMMNFMYSGELNME 419 Score = 32.7 bits (71), Expect = 0.19 Identities = 17/70 (24%), Positives = 33/70 (47%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELAS 427 + HK++L F + + ++ L+ VS+ L LLQ++Y G + + ELA Sbjct: 224 VPAHKVILQASGN-----FPLRSSDGDVIQLRGVSYPILHALLQYIYTGRTQILESELAP 278 Query: 428 FISTAEQLQV 457 + + +V Sbjct: 279 LRDLSSKFEV 288 >At1g01640.2 68414.m00082 speckle-type POZ protein-related contains Pfam profile:PF00651 BTB/POZ domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 207 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMF---KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEE 418 I THK VL+ S F+ M + + + L D+SH L+ LL+F+Y G + + Sbjct: 37 IPTHKAVLAARSKVFRNMLDSDECKTSPEESITLPDLSHDELKSLLEFLYSGNLKAPYNQ 96 Query: 419 LASFISTAEQLQV 457 S A++ + Sbjct: 97 YRSLYLAADKYDI 109 >At1g01640.1 68414.m00081 speckle-type POZ protein-related contains Pfam profile:PF00651 BTB/POZ domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 207 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMF---KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEE 418 I THK VL+ S F+ M + + + L D+SH L+ LL+F+Y G + + Sbjct: 37 IPTHKAVLAARSKVFRNMLDSDECKTSPEESITLPDLSHDELKSLLEFLYSGNLKAPYNQ 96 Query: 419 LASFISTAEQLQV 457 S A++ + Sbjct: 97 YRSLYLAADKYDI 109 >At4g08455.1 68417.m01394 BTB/POZ domain-containing protein Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to POZ 56 protein (GI:17483747) [Mus musculus] Length = 243 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEEL 421 I HK VL SP F+ M + M + + + DVS+ ALR + ++Y E + ++ Sbjct: 80 IPAHKSVLVSRSPVFKAMLENEMEESLSGTIKISDVSYDALRTFVYYLYTAEACLDEQMA 139 Query: 422 ASFISTAEQLQVK 460 + +E+ QVK Sbjct: 140 CDLLVMSEKYQVK 152 >At5g21010.1 68418.m02497 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF00917: MATH domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 410 Score = 33.1 bits (72), Expect = 0.14 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +2 Query: 257 HKLVLSVCSPYFQ-EMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQ 391 HKLVL+ SP+F+ + F + V + D+ + LLQFMY+ Sbjct: 212 HKLVLAARSPFFKSKFFSEFEANNTEVTINDLEPKVFKALLQFMYK 257 >At3g43700.1 68416.m04664 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF00917: MATH domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 415 Score = 30.7 bits (66), Expect = 0.77 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 257 HKLVLSVCSPYFQEMFKMNPTQ-HPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELAS 427 HKLVL+ S +F+ MF + + V + D+ + LL FMY+ + E L + Sbjct: 219 HKLVLAARSQFFRSMFYNTLAENNSDVVISDLEPKVFKALLHFMYKDSLPGDVEPLTA 276 >At5g48510.1 68418.m05998 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 224 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 9/72 (12%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFKMN----PTQH-PIVFLKDVSHSALRDLLQFMYQG----EV 400 I+ HKL+L+ S F+ MF+++ T+H + L ++ H L ++F+ Sbjct: 39 ISAHKLILASRSEVFKNMFELDEFKTSTKHVETITLSEMKHEELEAFVEFICSDGSMLSA 98 Query: 401 NVKQEELASFIS 436 NVKQ + +++ Sbjct: 99 NVKQHARSLYLA 110 >At4g04090.1 68417.m00578 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 192 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFKMN----PTQHPIVFLKDVSHSALRDLLQFMY 388 I+ HK +LS S F+EMF+ + ++ + L ++ H L + F Y Sbjct: 38 ISAHKRILSARSEVFEEMFESDKYKASSKLETITLSEMKHEVLEAFVDFTY 88 >At5g45110.1 68418.m05536 ankyrin repeat family protein / BTB/POZ domain-containing protein contains Pfam domain, PF00023: Ankyrin repeat and Pfam domain, PF00651: BTB/POZ domain Length = 586 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 10/61 (16%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMF----KMNPTQHPIVFLKD------VSHSALRDLLQFMYQGE 397 + H+ +L+ S +FQ++F K++ T+ P L++ V+H A L ++Y G Sbjct: 71 VGVHRCILAARSKFFQDLFKKEKKISKTEKPKYQLREMLPYGAVAHEAFLYFLSYIYTGR 130 Query: 398 V 400 + Sbjct: 131 L 131 >At2g40440.1 68415.m04990 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; Length = 194 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +2 Query: 251 ATHKLVLSVCSPYFQEMFKMN----PTQHPIVFLKDVSHSALRDLLQFMY 388 + HKLVLS S F++M + + Q + L ++ H L ++F+Y Sbjct: 41 SAHKLVLSARSEVFKKMLESDEIKASAQLETITLCEMKHEELEAFIEFIY 90 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,881,361 Number of Sequences: 28952 Number of extensions: 225753 Number of successful extensions: 484 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -