BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0777 (528 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 2.6 EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 21 5.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.9 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 7.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 7.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 7.8 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.6 bits (46), Expect = 2.6 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +1 Query: 1 ENSSRVFF-FFFLSQNPFYFLMIFSKHRLI 87 + +SR+ F FFL+ N FY+ S+ I Sbjct: 424 DRASRIVFPLFFLAINVFYWFAYLSRSERI 453 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 21.4 bits (43), Expect = 5.9 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +3 Query: 261 QSGFSIEGSYTISAPSI 311 ++GF ++GS+ +AP I Sbjct: 93 ENGFQVQGSHIPTAPPI 109 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 5.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 424 LLTLSNSYVVPSKIV*FSDKY 486 ++ L+ S VP+KI F DK+ Sbjct: 1266 IVALAPSVRVPAKIASFDDKF 1286 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/29 (24%), Positives = 14/29 (48%) Frame = -2 Query: 464 IFDGTTYELDNVSRVANLWNGWTDFDGTF 378 +F +L +V++ N WN W + + Sbjct: 681 LFKDEAKDLVSVNKSWNKWNDWQETQNNY 709 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/29 (24%), Positives = 14/29 (48%) Frame = -2 Query: 464 IFDGTTYELDNVSRVANLWNGWTDFDGTF 378 +F +L +V++ N WN W + + Sbjct: 681 LFKDEAKDLVSVNKSWNKWNDWQETQNNY 709 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/29 (24%), Positives = 14/29 (48%) Frame = -2 Query: 464 IFDGTTYELDNVSRVANLWNGWTDFDGTF 378 +F +L +V++ N WN W + + Sbjct: 681 LFKDEAKDLVSVNKSWNKWNDWQETQNNY 709 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,222 Number of Sequences: 438 Number of extensions: 2901 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14845611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -