BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0763 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g27480.1 68415.m03321 calcium-binding EF hand family protein ... 29 1.8 At2g31220.1 68415.m03813 basic helix-loop-helix (bHLH) family pr... 27 7.2 >At2g27480.1 68415.m03321 calcium-binding EF hand family protein similar to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 186 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 57 VRLQKLTFVDGSYTIRLWECSARVRAVFTSAHRGR 161 +RL K T+ Y + LW C A+ RA+F R R Sbjct: 62 LRLGKFTYCPKEY-VELWNCLAQWRAIFNRYDRDR 95 >At2g31220.1 68415.m03813 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 458 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 477 SRYSERDAGPPSGAVVGADAAANIFNCCSPVAEQKEFHM 593 S +S+ + PP V+ A + +N NC V E EFH+ Sbjct: 27 SSFSQAEPPPPPPQVLVAGSTSNS-NCSVEVEELSEFHL 64 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,688,083 Number of Sequences: 28952 Number of extensions: 176488 Number of successful extensions: 416 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -