BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0756 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 1.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.1 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 22 6.4 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 499 GGRQASAGVNGSRVSAXVGAQFSLTL 576 GG A GV G +++ V SLTL Sbjct: 7 GGSSAGVGVVGGTIASVVAGAASLTL 32 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 2.1 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = +3 Query: 60 VHLSKQKQTQDKMC-DRKAVIKNADMSEEMQQDAVDCATQALEKFNIEKXIAAF-IKKEF 233 +H ++ K+T DK+C + V+ A AV+ ++ + +EK AA +KK Sbjct: 1689 IHRTQVKETDDKICFTMRPVVSCASGC-----TAVETKSKPYKFHCMEKNEAAMKLKKRI 1743 Query: 234 DKKYNP 251 +K NP Sbjct: 1744 EKGANP 1749 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 21.8 bits (44), Expect = 6.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 182 ERLSCTVNSILLHLFAH 132 ER+ C+ NS++ H++ + Sbjct: 42 ERVYCSRNSLMTHIYTY 58 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,675 Number of Sequences: 438 Number of extensions: 3418 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -