BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0754 (389 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1131 + 27872870-27872958,27873036-27873281,27874058-278741... 27 4.0 >06_03_1131 + 27872870-27872958,27873036-27873281,27874058-27874163, 27874665-27875209,27875455-27875914,27876234-27876319, 27877092-27877194 Length = 544 Score = 27.5 bits (58), Expect = 4.0 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 111 LYSILHF--RFKPVCLFSTLLRRKLHKCTNIDY 19 L I HF RFK V L +L R+LH ++D+ Sbjct: 503 LMDIDHFAMRFKQVILIVCILARRLHSAGDVDF 535 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,050,999 Number of Sequences: 37544 Number of extensions: 96706 Number of successful extensions: 117 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 660830060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -