SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0738
         (459 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000D563E5 Cluster: PREDICTED: similar to CG11323-PA...    34   1.3  

>UniRef50_UPI0000D563E5 Cluster: PREDICTED: similar to CG11323-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG11323-PA - Tribolium castaneum
          Length = 833

 Score = 34.3 bits (75), Expect = 1.3
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +1

Query: 304 PSSAISFSKSDHGPETTSSTGQLXQYKSWVXXERXDELKKIAETAMKQRKVF 459
           P   I+   S  G + ++S  +  +YK  +  ER   L+KI ETA+K+ KVF
Sbjct: 54  PKHGIAPETSAEGMKRSNSCIE-NKYKCTITSERLSRLRKIVETAVKEHKVF 104


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 273,042,241
Number of Sequences: 1657284
Number of extensions: 3490769
Number of successful extensions: 4825
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4788
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4825
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 24351434270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -