BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0737 (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 27 0.12 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 23 2.6 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 27.1 bits (57), Expect = 0.12 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -3 Query: 242 PSAANVTSTRSPRDSRP*KPADIFAWKLFQHSENCSSDAMIATTRRGT 99 P+ A+ T T S S PA I ++ L QH CSS + +T T Sbjct: 203 PTIASATYTNSANSSIW-SPASIDSFTLEQHRSWCSSSQPVLSTTNST 249 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.6 bits (46), Expect = 2.6 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -3 Query: 176 IFAWKLFQHSENCSSDAMIATTRRGTYPKLXTYNSGRRNI*KKYNSMFP 30 I+ W+ E C+ + + TYP L T R + KY +++P Sbjct: 29 IWYWQCNTDEETCTRISSTVSRNTDTYPTLETC----RLVCGKYGALWP 73 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,494 Number of Sequences: 336 Number of extensions: 2622 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -