BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0725 (389 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1131 + 27872870-27872958,27873036-27873281,27874058-278741... 27 4.0 07_01_0636 + 4761858-4762421,4763596-4763819,4763961-4764309,476... 27 7.0 04_01_0055 + 576483-576584,576684-576865,576950-577316,577391-57... 27 7.0 >06_03_1131 + 27872870-27872958,27873036-27873281,27874058-27874163, 27874665-27875209,27875455-27875914,27876234-27876319, 27877092-27877194 Length = 544 Score = 27.5 bits (58), Expect = 4.0 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 111 LYSILHF--RFKPVCLFSTLLRRKLHKCTNIDY 19 L I HF RFK V L +L R+LH ++D+ Sbjct: 503 LMDIDHFAMRFKQVILIVCILARRLHSAGDVDF 535 >07_01_0636 + 4761858-4762421,4763596-4763819,4763961-4764309, 4764648-4765331 Length = 606 Score = 26.6 bits (56), Expect = 7.0 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 386 PSTTHLYFFRYTNNLMVKLIYKPYSKHLYSILR 288 P H++F ++ MVK+IY+P S + + R Sbjct: 315 PDQAHVFFLPFSVVKMVKMIYEPNSHDMDPLRR 347 >04_01_0055 + 576483-576584,576684-576865,576950-577316,577391-578065 Length = 441 Score = 26.6 bits (56), Expect = 7.0 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -1 Query: 386 PSTTHLYFFRYTNNLMVKLIYKPYSK 309 P+ H +F ++ + MVK +Y+P S+ Sbjct: 153 PTRAHAFFLPFSVSQMVKFVYRPPSQ 178 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,094,898 Number of Sequences: 37544 Number of extensions: 99463 Number of successful extensions: 131 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 660830060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -