BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0725 (389 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30130.1 68417.m04283 expressed protein contains Pfam domains... 27 4.5 At5g16750.1 68418.m01961 transducin family protein / WD-40 repea... 27 5.9 >At4g30130.1 68417.m04283 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 725 Score = 27.1 bits (57), Expect = 4.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 254 YVKILLTHRIQNTEDING*KVNS*FAVKHKNE 159 YVK H ++ TED NG K+ V+H NE Sbjct: 211 YVKFEDHHNMKATEDFNGGKMYQEDKVEHVNE 242 >At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats (PF00400); similar to transducin homolog sazD - Homo sapiens, EMBL:U02609 Length = 876 Score = 26.6 bits (56), Expect = 5.9 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 157 YSFLCFTANQEFTFYPLISSV 219 + LC TA+Q+F FY ++ +V Sbjct: 323 HGLLCVTADQQFFFYSVVENV 343 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,373,352 Number of Sequences: 28952 Number of extensions: 96400 Number of successful extensions: 170 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 170 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 557595584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -