BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0720 (349 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4FTH3 Cluster: Putative uncharacterized protein; n=2; ... 31 4.1 UniRef50_A2EKF5 Cluster: Cyclin, N-terminal domain containing pr... 31 7.2 >UniRef50_Q4FTH3 Cluster: Putative uncharacterized protein; n=2; Psychrobacter|Rep: Putative uncharacterized protein - Psychrobacter arcticum Length = 565 Score = 31.5 bits (68), Expect = 4.1 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -2 Query: 255 ELAGDTDKVQEVQLPLCHLLHLAVTTILVVTSAKTVEFLEDN 130 +L T V + LP HLLH +T IL T EF +DN Sbjct: 13 KLTAPTLSVTDFNLPSLHLLHDEITVILKDTEIHLGEFNDDN 54 >UniRef50_A2EKF5 Cluster: Cyclin, N-terminal domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Cyclin, N-terminal domain containing protein - Trichomonas vaginalis G3 Length = 290 Score = 30.7 bits (66), Expect = 7.2 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +1 Query: 142 EFHSFCGRYDENSRNCEMKQMTQRKLHFLHLVRIPCQLVT 261 +F C E+ N + + Q +LH LHL+R + +T Sbjct: 150 DFDEICSFLVEDLENIVLDDIVQTELHILHLIRFNARFIT 189 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,502,456 Number of Sequences: 1657284 Number of extensions: 3223987 Number of successful extensions: 6377 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6377 length of database: 575,637,011 effective HSP length: 89 effective length of database: 428,138,735 effective search space used: 11131607110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -