BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0719 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 6.6 SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 27 8.7 SB_43390| Best HMM Match : fn3 (HMM E-Value=9.3e-30) 27 8.7 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/70 (22%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +3 Query: 327 VNPAAFGIHIPGKVLYFQVMIKSTXSLHHQH-SIFRFHVDVFLFVTRQVNRYLILVAFHA 503 ++P + HI + ++ IK LH+++ S+ + + R+ +AF Sbjct: 5830 IHPRGWYRHIAMRAEFYGCQIKFIPHLHNRYLSLPEAKNSLVTLLAESQQRFAADIAFTR 5889 Query: 504 SLFIMLGNFN 533 S F+ GNF+ Sbjct: 5890 SCFVFQGNFD 5899 >SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 942 Score = 27.9 bits (59), Expect = 6.6 Identities = 24/71 (33%), Positives = 32/71 (45%) Frame = -3 Query: 293 KQKQPEDSKRPVASPLRRPLRM*VVKRWSSPPRATCGTLTSAWRQPRRPMRSRKL*KRPR 114 K K+ + K P+ SP + R KR S P S R+ R RSR + +R R Sbjct: 292 KSKERKTLKSPIRSPRGQSSRERNTKRKSKSP--------SLERRRSRARRSRSIERRDR 343 Query: 113 TLSTSETMRSS 81 S S + RSS Sbjct: 344 RRSRSRSPRSS 354 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -3 Query: 491 DKYQISIHLPGYEQKDINVKAKNGVLMVQAXSAFNH-YLKIQNLPW 357 D Y++ + EQ+D N K G VQ FN+ Y I+ L W Sbjct: 22 DDYEVDENSDDEEQEDPNDYCKGGYHPVQLGDLFNNRYSVIRKLGW 67 >SB_43390| Best HMM Match : fn3 (HMM E-Value=9.3e-30) Length = 1043 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 386 HYLKIQNLPWDVNSEGSWVYEKDVLKITFPLKQKQP 279 H+L+I LP +VNS+ ++ D + + P+ P Sbjct: 839 HHLRISPLPINVNSQSGSTFQADCIIYSEPVDDSAP 874 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,387,384 Number of Sequences: 59808 Number of extensions: 338845 Number of successful extensions: 1048 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -