BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0719 (598 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022186-1|AAY51580.2| 381|Drosophila melanogaster IP01220p pro... 33 0.39 AE014297-2720|AAF55708.1| 381|Drosophila melanogaster CG17186-P... 33 0.39 >BT022186-1|AAY51580.2| 381|Drosophila melanogaster IP01220p protein. Length = 381 Score = 32.7 bits (71), Expect = 0.39 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = -2 Query: 327 RERRVENHLPAEAKAARG*QE--ASCKPTETTSTNVSREEMEFTTESNVRDVDVGLE 163 R +RVE PA+A+ R ++ +C P + ++T S+ EM+ +++N+ V LE Sbjct: 139 RIKRVEEPAPADAEKTRYTEDILTTCTPCDYSTTRKSQFEMQAKSQANIEVVQSQLE 195 >AE014297-2720|AAF55708.1| 381|Drosophila melanogaster CG17186-PA protein. Length = 381 Score = 32.7 bits (71), Expect = 0.39 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = -2 Query: 327 RERRVENHLPAEAKAARG*QE--ASCKPTETTSTNVSREEMEFTTESNVRDVDVGLE 163 R +RVE PA+A+ R ++ +C P + ++T S+ EM+ +++N+ V LE Sbjct: 139 RIKRVEEPAPADAEKTRYTEDILTTCTPCDYSTTRKSQFEMQAKSQANIEVVQSQLE 195 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,993,005 Number of Sequences: 53049 Number of extensions: 501790 Number of successful extensions: 1513 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1513 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2420893683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -