BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0719 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein /... 31 0.58 At5g14270.1 68418.m01669 DNA-binding bromodomain-containing prot... 28 5.4 At3g12200.1 68416.m01521 protein kinase family protein contains ... 28 5.4 At3g02980.1 68416.m00293 GCN5-related N-acetyltransferase (GNAT)... 28 5.4 At3g28345.1 68416.m03541 ABC transporter family protein similar ... 27 7.2 At1g35320.1 68414.m04378 expressed protein 27 9.5 >At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (bTAP) (Fragment) (SP:P58875) {Bos taurus}; similar to GI:807956 from [Saccharomyces cerevisiae]; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 573 Score = 31.1 bits (67), Expect = 0.58 Identities = 25/91 (27%), Positives = 37/91 (40%) Frame = -2 Query: 378 ENTEPSLGCEFRRQLGLRERRVENHLPAEAKAARG*QEASCKPTETTSTNVSREEMEFTT 199 E T+ E +++ E +VE PA AA + + P ET S E+ E TT Sbjct: 132 EETKEEEKTEEKKEETTTEVKVEEEKPA-VPAAEEEKSSEAAPVETKSEEKPEEKAEVTT 190 Query: 198 ESNVRDVDVGLETAQKTNEIAKAVEATTYAV 106 E + G +T + E +V AV Sbjct: 191 EKASSAEEDGTKTVEAIEESIVSVSPPESAV 221 >At5g14270.1 68418.m01669 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 688 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/74 (25%), Positives = 38/74 (51%) Frame = -2 Query: 345 RRQLGLRERRVENHLPAEAKAARG*QEASCKPTETTSTNVSREEMEFTTESNVRDVDVGL 166 R +L L++++ + L AEAKAA + + + ++ ++E E+ R + + Sbjct: 544 REELELQKKKEKARLQAEAKAAEEARRKAEAQAAAEAAAEAKRKLELEREA-ARQALMEM 602 Query: 165 ETAQKTNEIAKAVE 124 E + + NE AK +E Sbjct: 603 EQSVELNENAKFLE 616 >At3g12200.1 68416.m01521 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 571 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = -2 Query: 249 TETTST-NVSREEME--FTTESNVRDVDVGLETAQK 151 TET + N +E E F+ ES +RDVDVG+ +AQ+ Sbjct: 395 TETPAEENALPKETENIFSEESQLRDVDVGVVSAQE 430 >At3g02980.1 68416.m00293 GCN5-related N-acetyltransferase (GNAT) family protein contains Pfam profile: PF00583 acetyltransferase (GNAT) family Length = 247 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 369 LYFQVMIKSTXSLHHQHSIFRFHVDVFLFV 458 LY ++M + LH + I R H D FLFV Sbjct: 165 LYKRLMFRCVRRLHGFYLINRHHFDAFLFV 194 >At3g28345.1 68416.m03541 ABC transporter family protein similar to P-glycoprotein [Arabidopsis thaliana] GI:3849833; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1240 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -3 Query: 542 GAVVEVPQHYKQGRVEGDKYQISIHLPGYEQKDINVKAKNG 420 G +VE H + +Y +HL E++DINV K G Sbjct: 571 GHIVETGSHDELMENIDGQYSTLVHLQQIEKQDINVSVKIG 611 >At1g35320.1 68414.m04378 expressed protein Length = 199 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 6/47 (12%) Frame = -3 Query: 362 PWDVNSEGSWV------YEKDVLKITFPLKQKQPEDSKRPVASPLRR 240 P+ V SEG W ++ +VLKI FP K+ + V LRR Sbjct: 130 PFPVTSEGFWASSQRFCFQVEVLKIYFPTDLKESDREFGVVGKILRR 176 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,100,363 Number of Sequences: 28952 Number of extensions: 236618 Number of successful extensions: 693 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -