BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0717 (449 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|c... 25 4.1 SPCC1919.13c |||conserved eukaryotic protein|Schizosaccharomyces... 25 7.1 SPAC25B8.08 |||conserved fungal family|Schizosaccharomyces pombe... 25 7.1 SPAC18B11.03c |||N-acetyltransferase |Schizosaccharomyces pombe|... 24 9.4 >SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 436 Score = 25.4 bits (53), Expect = 4.1 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 71 FSNLK*NIYNFN*LISWTLFLHSSVHRSRILRV 169 F+NL NI +F L +++L L + H S IL V Sbjct: 399 FNNLCSNILHFRALSAYSLNLTADHHHSEILHV 431 >SPCC1919.13c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 282 Score = 24.6 bits (51), Expect = 7.1 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +1 Query: 232 IEAYGLGRVSRSVRATSMTMENVERLQNNSNXFWLYAKNGRG 357 IE G G+V + AT + + + Q FW + +G+G Sbjct: 110 IEING-GKVMHEIDATKLHLHKKLKTQKFDTIFWNFPHSGKG 150 >SPAC25B8.08 |||conserved fungal family|Schizosaccharomyces pombe|chr 1|||Manual Length = 590 Score = 24.6 bits (51), Expect = 7.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 297 CRTLTKQLKRFLAIRKERQRQXACGKLTDXKK 392 C T T QL RF+A+ + + A G L++ K Sbjct: 5 CNTETVQLYRFIAMDQWSDNKDAIGMLSESLK 36 >SPAC18B11.03c |||N-acetyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 440 Score = 24.2 bits (50), Expect = 9.4 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = -1 Query: 140 KNGEIVSMISIN*NYRYFILNSKKICKSRLYS*IIHLNIFE 18 KNG++ + I+ N R F+ +K+ + ++S + HLN F+ Sbjct: 256 KNGKVNLDMLIDVNARRFLPVAKQTMGNYVFSYVHHLNGFQ 296 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,647,896 Number of Sequences: 5004 Number of extensions: 30067 Number of successful extensions: 50 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 166231220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -