BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0714 (449 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 70 4e-14 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 70 4e-14 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 70 4e-14 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 69 6e-14 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 5.0 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 5.0 DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 22 8.7 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 22 8.7 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 69.7 bits (163), Expect = 4e-14 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = +2 Query: 239 KXCIATHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQ 412 K + H+ +LS CSPYF+++F N HPI++L+DV + +R LL FMYQGEVN Q Sbjct: 86 KGMVKAHQAILSACSPYFEQIFVENKHPHPIIYLRDVEVNEMRALLDFMYQGEVNVGQ 143 Score = 34.3 bits (75), Expect = 0.002 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 133 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 240 D+Q+ L WNN +N++ LL L DVTLA E Sbjct: 50 DQQYCLRWNNHQSNLTTVLTTLLQDEKLCDVTLACE 85 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 69.7 bits (163), Expect = 4e-14 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = +2 Query: 239 KXCIATHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQ 412 K + H+ +LS CSPYF+++F N HPI++L+DV + +R LL FMYQGEVN Q Sbjct: 86 KGMVKAHQAILSACSPYFEQIFVENKHPHPIIYLRDVEVNEMRALLDFMYQGEVNVGQ 143 Score = 34.3 bits (75), Expect = 0.002 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 133 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 240 D+Q+ L WNN +N++ LL L DVTLA E Sbjct: 50 DQQYCLRWNNHQSNLTTVLTTLLQDEKLCDVTLACE 85 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 69.7 bits (163), Expect = 4e-14 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = +2 Query: 239 KXCIATHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQ 412 K + H+ +LS CSPYF+++F N HPI++L+DV + +R LL FMYQGEVN Q Sbjct: 38 KGMVKAHQAILSACSPYFEQIFVENKHPHPIIYLRDVEVNEMRALLDFMYQGEVNVGQ 95 Score = 33.5 bits (73), Expect = 0.004 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +1 Query: 133 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 240 D+Q+ L WNN N++ LL L DVTLA E Sbjct: 2 DQQYCLRWNNHQPNLTTVLTTLLQDEKLCDVTLACE 37 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 69.3 bits (162), Expect = 6e-14 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = +2 Query: 239 KXCIATHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQ 412 K + H+ +LS CSPYF+++F N HPI++L+DV + +R LL FMYQGEVN Q Sbjct: 86 KGMVKAHQAILSACSPYFEQIFVENKHLHPIIYLRDVEVNEMRALLDFMYQGEVNVGQ 143 Score = 34.3 bits (75), Expect = 0.002 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 133 DEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 240 D+Q+ L WNN +N++ LL L DVTLA E Sbjct: 50 DQQYCLRWNNHQSNLTTVLTTLLQDEKLCDVTLACE 85 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 5.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 149 YAGTISTQICQRAF 190 Y GT+S +C+RA+ Sbjct: 50 YIGTVSLTLCERAY 63 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 5.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 149 YAGTISTQICQRAF 190 Y GT+S +C+RA+ Sbjct: 50 YIGTVSLTLCERAY 63 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 22.2 bits (45), Expect = 8.7 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 106 RRVVAIM-ASDEQFSLCWNNFHANMSAGFHGL 198 RRV+ ++ A F +CW FHA +G+ Sbjct: 264 RRVLKMLVAVVVAFFICWAPFHAQRLVYIYGV 295 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 22.2 bits (45), Expect = 8.7 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +2 Query: 230 WLPKXCIATHKLVLSVCSPYFQEMFKMN 313 +L C+A K ++ V S +F++ K+N Sbjct: 533 YLRLGCMARDKGLIFVASDFFKDALKIN 560 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 463,714 Number of Sequences: 2352 Number of extensions: 8327 Number of successful extensions: 67 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38268990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -