BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0714 (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 69 3e-14 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 57 8e-11 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 38 4e-05 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 2.0 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 3.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 3.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 3.6 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 6.2 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 8.2 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 8.2 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 8.2 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 8.2 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 68.5 bits (160), Expect = 3e-14 Identities = 27/55 (49%), Positives = 40/55 (72%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQ 412 + H++VLS CSPYF+E+ K P +HP++ L+DV+ S L L++F+Y GEVN Q Sbjct: 43 LKAHRVVLSACSPYFRELLKSTPCKHPVIVLQDVAFSDLHALVEFIYHGEVNVHQ 97 Score = 37.1 bits (82), Expect = 9e-05 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +1 Query: 124 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 240 M + F L WNN+ +++++ F L D VDVTLA + Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACD 39 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 57.2 bits (132), Expect = 8e-11 Identities = 26/67 (38%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFKMNPTQHP-IVFLKDVSHSALRDLLQFMYQGEVNXKQEX*H 424 + HK+VLS CS YFQ++ NP +HP I+ +DV + L+ +++F+Y+GE++ Q Sbjct: 47 LKAHKVVLSACSSYFQKLLLSNPCKHPTIIMPQDVCFNDLKFIIEFVYRGEIDVSQAELQ 106 Query: 425 HLLVQRD 445 LL D Sbjct: 107 SLLKTAD 113 Score = 37.9 bits (84), Expect = 5e-05 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +1 Query: 136 EQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLA 234 + + L WNN+ +NM++ FH LL VDVTLA Sbjct: 9 QHYCLRWNNYQSNMTSVFHQLLQTEAFVDVTLA 41 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 38.3 bits (85), Expect = 4e-05 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 124 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 240 M + F L WNN+ +++++ F L D VDVTLA E Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACE 39 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 2.0 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +1 Query: 100 VPRRVVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTL 231 V R +VA++ + F +CW FHA + S+ DV + Sbjct: 283 VIRMLVAVVVA---FFICWAPFHAQRLLAVYAQNSKDKPEDVLI 323 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 3.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 101 FHVESSLSWRRTNNFHY 151 + +S SWR TNN Y Sbjct: 211 YDFRNSRSWRITNNLFY 227 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 279 HTDRTNLCVAIHXFGSQRYVYEISTRQQA 193 H + T +++H G+ + E+ST QA Sbjct: 332 HVEVTPPLLSVHLGGNAEFRCEVSTHPQA 360 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 279 HTDRTNLCVAIHXFGSQRYVYEISTRQQA 193 H + T +++H G+ + E+ST QA Sbjct: 332 HVEVTPPLLSVHLGGNAEFRCEVSTHPQA 360 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = -1 Query: 143 NCSSDAMIATTRRGTYPKLCTYNS 72 NC D + +RGT + C + + Sbjct: 479 NCDIDCINRVVQRGTKMQFCIFRT 502 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 375 NKSLSAE*LTSFKNTIGCC 319 NKS L FK+T CC Sbjct: 41 NKSSGPNELGRFKHTDACC 59 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 375 NKSLSAE*LTSFKNTIGCC 319 NKS L FK+T CC Sbjct: 46 NKSSGPNELGRFKHTDACC 64 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 20.6 bits (41), Expect = 8.2 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 122 SWRRTNNFHY 151 SWR T+NF Y Sbjct: 209 SWRITHNFFY 218 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 375 NKSLSAE*LTSFKNTIGCC 319 NKS L FK+T CC Sbjct: 46 NKSSGPNELGRFKHTDACC 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,348 Number of Sequences: 438 Number of extensions: 2339 Number of successful extensions: 16 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -