BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0714 (449 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30600.2 68415.m03729 BTB/POZ domain-containing protein conta... 43 1e-04 At2g30600.1 68415.m03728 BTB/POZ domain-containing protein conta... 43 1e-04 At1g01640.2 68414.m00082 speckle-type POZ protein-related contai... 37 0.007 At1g01640.1 68414.m00081 speckle-type POZ protein-related contai... 37 0.007 At5g21010.1 68418.m02497 speckle-type POZ protein-related contai... 33 0.089 At4g08455.1 68417.m01394 BTB/POZ domain-containing protein Inter... 33 0.089 At3g43700.1 68416.m04664 speckle-type POZ protein-related contai... 30 0.63 At4g04090.1 68417.m00578 speckle-type POZ protein-related contai... 29 1.9 At5g48510.1 68418.m05998 speckle-type POZ protein-related contai... 28 3.4 At5g45110.1 68418.m05536 ankyrin repeat family protein / BTB/POZ... 28 3.4 At2g40440.1 68415.m04990 BTB/POZ domain-containing protein conta... 27 4.4 >At2g30600.2 68415.m03729 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 42.7 bits (96), Expect = 1e-04 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 2/52 (3%) Frame = +2 Query: 254 THKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVN 403 +HK++LS+ S F +MF M+ + ++L DVS A + ++ FMY GE+N Sbjct: 366 SHKVILSLWSVAFAKMFTNGMSESHSSTIYLTDVSPEAFKAMMNFMYSGELN 417 >At2g30600.1 68415.m03728 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 42.7 bits (96), Expect = 1e-04 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 2/52 (3%) Frame = +2 Query: 254 THKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVN 403 +HK++LS+ S F +MF M+ + ++L DVS A + ++ FMY GE+N Sbjct: 366 SHKVILSLWSVAFAKMFTNGMSESHSSTIYLTDVSPEAFKAMMNFMYSGELN 417 >At1g01640.2 68414.m00082 speckle-type POZ protein-related contains Pfam profile:PF00651 BTB/POZ domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 207 Score = 36.7 bits (81), Expect = 0.007 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMF---KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 400 I THK VL+ S F+ M + + + L D+SH L+ LL+F+Y G + Sbjct: 37 IPTHKAVLAARSKVFRNMLDSDECKTSPEESITLPDLSHDELKSLLEFLYSGNL 90 >At1g01640.1 68414.m00081 speckle-type POZ protein-related contains Pfam profile:PF00651 BTB/POZ domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 207 Score = 36.7 bits (81), Expect = 0.007 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMF---KMNPTQHPIVFLKDVSHSALRDLLQFMYQGEV 400 I THK VL+ S F+ M + + + L D+SH L+ LL+F+Y G + Sbjct: 37 IPTHKAVLAARSKVFRNMLDSDECKTSPEESITLPDLSHDELKSLLEFLYSGNL 90 >At5g21010.1 68418.m02497 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF00917: MATH domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 410 Score = 33.1 bits (72), Expect = 0.089 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +2 Query: 257 HKLVLSVCSPYFQ-EMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQ 391 HKLVL+ SP+F+ + F + V + D+ + LLQFMY+ Sbjct: 212 HKLVLAARSPFFKSKFFSEFEANNTEVTINDLEPKVFKALLQFMYK 257 >At4g08455.1 68417.m01394 BTB/POZ domain-containing protein Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to POZ 56 protein (GI:17483747) [Mus musculus] Length = 243 Score = 33.1 bits (72), Expect = 0.089 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFK--MNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNXKQEX* 421 I HK VL SP F+ M + M + + + DVS+ ALR + ++Y E ++ Sbjct: 80 IPAHKSVLVSRSPVFKAMLENEMEESLSGTIKISDVSYDALRTFVYYLYTAEACLDEQMA 139 Query: 422 HHLLVQRD 445 LLV + Sbjct: 140 CDLLVMSE 147 >At3g43700.1 68416.m04664 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; contains Pfam PF00917: MATH domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 415 Score = 30.3 bits (65), Expect = 0.63 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +2 Query: 257 HKLVLSVCSPYFQEMFKMNPTQ-HPIVFLKDVSHSALRDLLQFMYQ 391 HKLVL+ S +F+ MF + + V + D+ + LL FMY+ Sbjct: 219 HKLVLAARSQFFRSMFYNTLAENNSDVVISDLEPKVFKALLHFMYK 264 >At4g04090.1 68417.m00578 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 192 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFKMN----PTQHPIVFLKDVSHSALRDLLQFMY 388 I+ HK +LS S F+EMF+ + ++ + L ++ H L + F Y Sbjct: 38 ISAHKRILSARSEVFEEMFESDKYKASSKLETITLSEMKHEVLEAFVDFTY 88 >At5g48510.1 68418.m05998 speckle-type POZ protein-related contains Pfam PF00651 : BTB/POZ domain; similar to Speckle-type POZ protein (SP:O43791) [Homo sapiens] Length = 224 Score = 27.9 bits (59), Expect = 3.4 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFKMN----PTQH-PIVFLKDVSHSALRDLLQFM 385 I+ HKL+L+ S F+ MF+++ T+H + L ++ H L ++F+ Sbjct: 39 ISAHKLILASRSEVFKNMFELDEFKTSTKHVETITLSEMKHEELEAFVEFI 89 >At5g45110.1 68418.m05536 ankyrin repeat family protein / BTB/POZ domain-containing protein contains Pfam domain, PF00023: Ankyrin repeat and Pfam domain, PF00651: BTB/POZ domain Length = 586 Score = 27.9 bits (59), Expect = 3.4 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 10/61 (16%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMF----KMNPTQHPIVFLKD------VSHSALRDLLQFMYQGE 397 + H+ +L+ S +FQ++F K++ T+ P L++ V+H A L ++Y G Sbjct: 71 VGVHRCILAARSKFFQDLFKKEKKISKTEKPKYQLREMLPYGAVAHEAFLYFLSYIYTGR 130 Query: 398 V 400 + Sbjct: 131 L 131 >At2g40440.1 68415.m04990 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; Length = 194 Score = 27.5 bits (58), Expect = 4.4 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Frame = +2 Query: 251 ATHKLVLSVCSPYFQEMFKMN----PTQHPIVFLKDVSHSALRDLLQFMY-QGEVNXKQE 415 + HKLVLS S F++M + + Q + L ++ H L ++F+Y G + +E Sbjct: 41 SAHKLVLSARSEVFKKMLESDEIKASAQLETITLCEMKHEELEAFIEFIYSDGSMLSAKE 100 Query: 416 X*HHL 430 H + Sbjct: 101 KQHKM 105 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,249,055 Number of Sequences: 28952 Number of extensions: 180029 Number of successful extensions: 362 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 359 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -