BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0713 (289 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C11.11 |cka1|orb5|serine/threonine protein kinase Cka1|Sch... 24 3.8 SPAC13G6.03 |gpi7||GPI anchor biosynthesis protein Gpi7 |Schizos... 24 3.8 SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosac... 23 8.8 >SPAC23C11.11 |cka1|orb5|serine/threonine protein kinase Cka1|Schizosaccharomyces pombe|chr 1|||Manual Length = 332 Score = 24.2 bits (50), Expect = 3.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 85 EFHSFCGRYDENSRNCEMKQMTQRKLHFLHLVRIPCQ 195 +++SF R + + N E + R L + H R+ CQ Sbjct: 284 DWYSFVNRDNRSLANDEAIDLLNRLLRYDHQERLTCQ 320 >SPAC13G6.03 |gpi7||GPI anchor biosynthesis protein Gpi7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 758 Score = 24.2 bits (50), Expect = 3.8 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = -3 Query: 161 SFLCVICFISQLRLF--SS*RPQKLWNS 84 +FLC+ CFI + LF S P+ L+N+ Sbjct: 710 TFLCISCFIMRHHLFVWSVFSPKLLYNA 737 >SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 848 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = -3 Query: 185 IRTRCRKCSFLCVICFISQLRLFSS*RPQKLWN 87 ++T R+ + LC++ I +L L + RP+++ N Sbjct: 291 VKTAEREAALLCILQDIIKLPLKDNVRPREIGN 323 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,268 Number of Sequences: 5004 Number of extensions: 8823 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 2,362,478 effective HSP length: 62 effective length of database: 2,052,230 effective search space used: 67723590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -