BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0712 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 95 1e-21 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 5.0 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 6.6 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 8.8 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 23 8.8 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 8.8 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 95.1 bits (226), Expect = 1e-21 Identities = 44/80 (55%), Positives = 54/80 (67%) Frame = +2 Query: 308 FAPEEISVKTADGYIVVEGKHEEKKDQHGYISRQFTRRYALPEGCTAESVESRLSSDGVL 487 F+PEEISVK D ++VEGKHEEK+D HGY+SR F RRY LP+G + S LSSDG+L Sbjct: 24 FSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLPKGHNEADIVSSLSSDGIL 83 Query: 488 SVIAPRXCPPAVEGERKIPI 547 ++ PR ER IPI Sbjct: 84 TITCPRKEIEQKNEERSIPI 103 Score = 29.5 bits (63), Expect = 0.076 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +3 Query: 255 SSIXSDKDKFQVNLDVQH-SPRKKSL 329 S++ KDKFQ+NLDVQ SP + S+ Sbjct: 6 SAVNISKDKFQINLDVQQFSPEEISV 31 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 23.4 bits (48), Expect = 5.0 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 73 KMSLIPWLXXYEIERPRRLMDQHFGLGLTPEDFLSAAAGPLVS 201 K+ PW E E+P H G + E ++ AA + S Sbjct: 115 KIDEFPWTALIEYEKPNGRFGFHCGGSVINERYILTAAHCITS 157 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 6.6 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +2 Query: 395 YISRQFTRRYALPEGCTAESVESRLSSDGVLSVIAP 502 Y+S +F +P+GC + L + V +V+ P Sbjct: 661 YLSEEFFCTSGVPQGCVLSPLLFSLFINDVCNVLPP 696 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 22.6 bits (46), Expect = 8.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 144 RLGADSGRFSQCCSRPPCEQRILPPVASPCCRGSR 248 R+ +FSQ + CEQ+ LP V S C G++ Sbjct: 347 RMAKSKRKFSQ---QNCCEQQHLPHVHSEKCAGTQ 378 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 22.6 bits (46), Expect = 8.8 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 204 RILPPVASPCCRGSRPWSSIXSDKD 278 R L PVASP CR R + S K+ Sbjct: 153 RPLEPVASPVCRMMRANVRVLSWKE 177 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 22.6 bits (46), Expect = 8.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 525 STAGGXFLGAITDNTPSEDSR 463 S+ GG +G TD PSE R Sbjct: 1016 SSGGGPPVGTPTDGAPSEGRR 1036 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,756 Number of Sequences: 2352 Number of extensions: 11497 Number of successful extensions: 19 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -