BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0708 (298 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78539-5|CAB01733.2| 1272|Caenorhabditis elegans Hypothetical pr... 27 3.2 AF025461-4|AAB70993.1| 270|Caenorhabditis elegans Hypothetical ... 25 9.7 >Z78539-5|CAB01733.2| 1272|Caenorhabditis elegans Hypothetical protein C31E10.8 protein. Length = 1272 Score = 26.6 bits (56), Expect = 3.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 148 HSFCGRYDENSRNCEMKQMTQRKL 219 H+FC RY E R + + MT RK+ Sbjct: 34 HTFCNRYSEAERT-KYQMMTHRKI 56 >AF025461-4|AAB70993.1| 270|Caenorhabditis elegans Hypothetical protein M01D1.7 protein. Length = 270 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 57 SKXQGLFYIKN*QFTQGSALXLTTSCLLGI 146 SK LFYI++ + + S +T CL G+ Sbjct: 117 SKIAFLFYIQSNEVSDESQFQMTVDCLKGV 146 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,720,749 Number of Sequences: 27780 Number of extensions: 66239 Number of successful extensions: 136 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 12,740,198 effective HSP length: 70 effective length of database: 10,795,598 effective search space used: 302276744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -