BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0707 (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 27 0.27 AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 23 5.8 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 23 7.6 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 7.6 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 27.5 bits (58), Expect = 0.27 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -1 Query: 322 NPIAVLFGEXXRWADNFTLNKLDAQSGLKMLLEYFVHGIIEYDLGSILLV 173 NP + FG+ R KL GL MLL+ + + + D+ LL+ Sbjct: 428 NPSYLAFGDGPRMCIAMRFGKLQTCLGLAMLLKSYTFSLEDCDVDRPLLI 477 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 23.0 bits (47), Expect = 5.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 102 SWIVARRTSAKAFAKGVFINQERKLEVRR 16 +W++ RT KG Q +KLE R+ Sbjct: 23 TWVMVYRTEKYQKLKGEVEKQSKKLEKRK 51 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 22.6 bits (46), Expect = 7.6 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -3 Query: 425 CAPRCRCTH 399 C P C CTH Sbjct: 604 CGPNCMCTH 612 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 280 DNFTLNKLDAQSGLKMLLE 224 D F +NK+D +KM+L+ Sbjct: 2885 DKFVINKMDKIKDMKMVLK 2903 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 457,725 Number of Sequences: 2352 Number of extensions: 7766 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -