BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0707 (499 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55372-1|AAA98002.2| 816|Caenorhabditis elegans Hypothetical pr... 28 4.3 Z81143-5|CAB03518.2| 370|Caenorhabditis elegans Hypothetical pr... 27 7.6 U53335-2|AAU87823.1| 190|Caenorhabditis elegans Hypothetical pr... 27 7.6 >U55372-1|AAA98002.2| 816|Caenorhabditis elegans Hypothetical protein C02G6.2 protein. Length = 816 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = -1 Query: 340 TPVQYQNPIAVLFGEXXRWADNFTLNKLD---AQSGLKMLLEYFVHGIIE 200 TP+ QNPI L W N TL + A +GLK LE +G+ E Sbjct: 546 TPIVAQNPIMSLISSLWLWCLNDTLTEETYNAAIAGLKFQLESGHNGVHE 595 >Z81143-5|CAB03518.2| 370|Caenorhabditis elegans Hypothetical protein ZK265.7 protein. Length = 370 Score = 27.1 bits (57), Expect = 7.6 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 302 EEHRDRILILNRRFLERRLTDDMLRKRV 385 EE R+R + RR ERRL +D + +R+ Sbjct: 294 EEERERYRMERRRAEERRLQEDTILRRI 321 >U53335-2|AAU87823.1| 190|Caenorhabditis elegans Hypothetical protein C55C3.7 protein. Length = 190 Score = 27.1 bits (57), Expect = 7.6 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 Query: 458 GGLF*KARSCICAPRCRCTHP 396 G LF + R CI AP C CT P Sbjct: 7 GTLF-QTRDCISAPVCNCTGP 26 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,164,677 Number of Sequences: 27780 Number of extensions: 186079 Number of successful extensions: 364 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -