BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0701 (269 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78067-9|CAB01528.2| 450|Caenorhabditis elegans Hypothetical pr... 27 2.4 Z70211-2|CAA94158.2| 272|Caenorhabditis elegans Hypothetical pr... 25 5.6 Z83105-9|CAB05489.1| 199|Caenorhabditis elegans Hypothetical pr... 25 7.3 AC024826-17|AAF60789.1| 662|Caenorhabditis elegans Hypothetical... 25 7.3 >Z78067-9|CAB01528.2| 450|Caenorhabditis elegans Hypothetical protein ZC412.1 protein. Length = 450 Score = 26.6 bits (56), Expect = 2.4 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +3 Query: 21 SYQFYRNAEVKTLILLNISLCFD 89 SY Y + +KT+++ N++LC D Sbjct: 158 SYPLYYSQNLKTMVIENVTLCGD 180 >Z70211-2|CAA94158.2| 272|Caenorhabditis elegans Hypothetical protein K11E4.2 protein. Length = 272 Score = 25.4 bits (53), Expect = 5.6 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -3 Query: 195 NISSCSTCKW*CTESRGRSMGRSKNRRVLHTYSYRDRSKG*YLKV 61 NISS + + + R +GR KN ++ H Y YR+ YL + Sbjct: 92 NISSFTITCFHIQDGRTHLLGRYKNNQISH-YKYREIDGRHYLGI 135 >Z83105-9|CAB05489.1| 199|Caenorhabditis elegans Hypothetical protein F14H3.9 protein. Length = 199 Score = 25.0 bits (52), Expect = 7.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 17 PFIPILQKR*SENFDTFKY 73 PFI L K S NF+ FKY Sbjct: 116 PFIACLSKLRSSNFNIFKY 134 >AC024826-17|AAF60789.1| 662|Caenorhabditis elegans Hypothetical protein Y55F3AM.14 protein. Length = 662 Score = 25.0 bits (52), Expect = 7.3 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 267 TXHHFALNTDGCHRRHPRRYVSEFNISSCSTCK 169 T F+ N DGC + +R + ++ SC K Sbjct: 416 TDSQFSHNCDGCGKSFVQRIALQIHVDSCEPHK 448 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,429,943 Number of Sequences: 27780 Number of extensions: 51171 Number of successful extensions: 138 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 12,740,198 effective HSP length: 68 effective length of database: 10,851,158 effective search space used: 227874318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -