BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0700 (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB17E12.03 |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 27 1.8 SPBC3E7.15c |mug83|SPBC4F6.02c|sphingosine N-acyltransferase Lac... 26 3.2 SPAC6F12.08c |||exocyst complex subunit Exo84|Schizosaccharomyce... 25 7.3 >SPAPB17E12.03 |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 311 Score = 27.1 bits (57), Expect = 1.8 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 245 LLKPSLKYYLFFFTTIFVAMIT*NY-LFNGIYVSIK**VTRALTNKQN 105 L+ PSL++ L +FT + + Y F+GIY+ +K + ++ K N Sbjct: 18 LISPSLRFILAYFTHRYPRFLLRAYNSFDGIYLLVKLLLEKSQLKKWN 65 >SPBC3E7.15c |mug83|SPBC4F6.02c|sphingosine N-acyltransferase Lac1|Schizosaccharomyces pombe|chr 2|||Manual Length = 384 Score = 26.2 bits (55), Expect = 3.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 470 NIRFCIFYFLFFATC 514 +I FC+FY LFF C Sbjct: 105 DIAFCLFYALFFTFC 119 >SPAC6F12.08c |||exocyst complex subunit Exo84|Schizosaccharomyces pombe|chr 1|||Manual Length = 578 Score = 25.0 bits (52), Expect = 7.3 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -3 Query: 501 NKK*NIQNLMFHYTQRRGINLFHPCTYLLYILSIGY 394 N+K + ++ H +GI+L H + Y+ S+G+ Sbjct: 414 NRKRKVTEILLHQLGFKGISLSHGKEIVRYLRSLGH 449 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,905,676 Number of Sequences: 5004 Number of extensions: 34988 Number of successful extensions: 72 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -