SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0700
         (548 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g18350.1 68416.m02334 expressed protein contains Pfam profile...    30   1.2  

>At3g18350.1 68416.m02334 expressed protein contains Pfam profile:
           PF04842 plant protein of unknown function (DUF639)
          Length = 692

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 13/37 (35%), Positives = 24/37 (64%)
 Frame = +2

Query: 347 ILC*KIFALLSLNGGQ*PIDSIYNKYVHGWKRFIPRL 457
           I+C  +F +L+ + G     S+Y+KY+HG +R I ++
Sbjct: 166 IICDNLFQMLTSSTGGRLQFSVYDKYLHGLERAIKKM 202


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,423,798
Number of Sequences: 28952
Number of extensions: 162242
Number of successful extensions: 284
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 283
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 284
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1033331880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -