BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0694 (659 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27105| Best HMM Match : GDC-P (HMM E-Value=0) 131 4e-31 SB_2835| Best HMM Match : Spectrin (HMM E-Value=0.14) 29 3.4 SB_8274| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_48196| Best HMM Match : AcetylCoA_hydro (HMM E-Value=1.5e-19) 28 5.9 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 28 5.9 >SB_27105| Best HMM Match : GDC-P (HMM E-Value=0) Length = 767 Score = 131 bits (317), Expect = 4e-31 Identities = 57/81 (70%), Positives = 70/81 (86%) Frame = +2 Query: 266 MNISEPISEYDLIERVRLIAEKNEIWRSYIGMGYHNCCVPHAIMRNMFENPGWTTQYTPY 445 + +SE ISE DL+ R+R I++ N+IWRSYIGMGY++C VP I+RN+ ENPGWTT YTPY Sbjct: 20 LQLSEAISEPDLLSRLRQISKGNQIWRSYIGMGYYSCHVPTTILRNILENPGWTTPYTPY 79 Query: 446 QPEVAQGRLESLLNYQTMVSD 508 QPE+AQGRLESLLN+QTMVSD Sbjct: 80 QPELAQGRLESLLNFQTMVSD 100 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = +1 Query: 508 LTGLDVANASLLDEGTAAAEALSLCH 585 LTGLD+ANASLLDE TAAAEA++LC+ Sbjct: 101 LTGLDIANASLLDEATAAAEAMALCY 126 >SB_2835| Best HMM Match : Spectrin (HMM E-Value=0.14) Length = 1089 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +2 Query: 182 YYVRFIRIQEFRPVNQ*CSTKEDSIQGLMNISEPISEYDLIE 307 YYV ++ E R +++ +ED +Q L++ S+PI +L+E Sbjct: 408 YYVTTYQM-ELRKIHRDARAEEDRLQHLLDESDPIQTEELVE 448 >SB_8274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +2 Query: 182 YYVRFIRIQEFRPVNQ*CSTKEDSIQGLMNISEPISEYDLIE 307 YYV ++ E R +++ +ED +Q L++ S+PI +L+E Sbjct: 107 YYVTTYQM-ELRKIHRDARAEEDRLQHLLDESDPIQTEELVE 147 >SB_48196| Best HMM Match : AcetylCoA_hydro (HMM E-Value=1.5e-19) Length = 381 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 225 LTGLNSCILINLT**LYPDPLGQCVYSG 142 +T +NSCI ++LT + D +G +YSG Sbjct: 250 MTAINSCIEVDLTGQVVSDSIGTRMYSG 277 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +2 Query: 524 LLMLPYWMRVRLLPKHFHCVTGITNEQSSSCPKRLHPQTLAVVHT 658 L + P W + H + I SSS P R H T A+++T Sbjct: 237 LALAPPWRIIHNYRHHLYTTVIIYTPPSSSIPHRHHLYTTAIIYT 281 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,245,637 Number of Sequences: 59808 Number of extensions: 455755 Number of successful extensions: 1192 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1192 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -