BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0693 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40574| Best HMM Match : Dynein_light (HMM E-Value=0) 101 4e-22 SB_6167| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_13708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_40574| Best HMM Match : Dynein_light (HMM E-Value=0) Length = 89 Score = 101 bits (243), Expect = 4e-22 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = +3 Query: 96 MCDRKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPT 254 M +RKAVIKNADM+E+MQ DA++CATQALEKFNIEKDIAAFIKKEFDKKYNPT Sbjct: 1 MSERKAVIKNADMAEDMQTDAIECATQALEKFNIEKDIAAFIKKEFDKKYNPT 53 Score = 63.3 bits (147), Expect = 2e-10 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 257 HCIVGRNFGSYVTHETRHFIYFYLGQ 334 HCIVGRNFGSYVTHET+HFIYFYLGQ Sbjct: 55 HCIVGRNFGSYVTHETKHFIYFYLGQ 80 >SB_6167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +3 Query: 114 VIKNADMSEEMQQDAVDCATQALEKFNIEKDIAA-FIKKEFDKKYNPTGIASWVVIL 281 +I+ +DM++EM+ +A++ A EKF+ + AA IK+ DKK+ ASW ++ Sbjct: 26 LIRYSDMNDEMRTEAMELCVTACEKFSNNNETAAKMIKESMDKKFG----ASWHAVV 78 Score = 35.1 bits (77), Expect = 0.050 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 257 HCIVGRNFGSYVTHETRHFIYFYLGQW 337 H +VG FG +THE R+ +Y + G++ Sbjct: 75 HAVVGEGFGFEITHEVRNLLYMFFGKY 101 >SB_13708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -1 Query: 465 NVPQPEPRMRICKGYPSDNTASAANKKIEVMLNGLT 358 N P EP + + G P DNT ++ KI V NG + Sbjct: 7 NRPVHEP-LAVLSGVPKDNTIPSSAPKISVSKNGFS 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,166,083 Number of Sequences: 59808 Number of extensions: 413013 Number of successful extensions: 1281 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1279 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -