BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0692 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0172 - 15082426-15082616,15084243-15084741 28 4.9 02_04_0648 - 24716249-24717841 27 8.6 >03_03_0172 - 15082426-15082616,15084243-15084741 Length = 229 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 424 QDVELKPWSSSWLSPAAVLK*YR*HLSLRPNITP 525 QD SS+W +P A + R LSLRP TP Sbjct: 40 QDESEDVGSSTWTAPMATSRGVRFQLSLRPKETP 73 >02_04_0648 - 24716249-24717841 Length = 530 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 584 PNPGNRIIQPFGVLESACDLGVILGRRLKCH 492 P P N+ + P VL +AC +GV L R + CH Sbjct: 111 PAP-NQFVYPL-VLRAACAIGVQLVRSIHCH 139 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,022,119 Number of Sequences: 37544 Number of extensions: 249154 Number of successful extensions: 517 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -