BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0688 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56046| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_17112| Best HMM Match : Trypsin (HMM E-Value=0) 29 2.9 >SB_56046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 674 Score = 53.2 bits (122), Expect = 2e-07 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +3 Query: 351 LQDRNEKLFFSLLDCDIEKFMPIVYTPTVGLACQKFG 461 L +RNE LFF +L E+ MPIVYTPTVGLAC+K+G Sbjct: 125 LLERNESLFFRVLFDYTEELMPIVYTPTVGLACRKYG 161 Score = 35.9 bits (79), Expect = 0.025 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +2 Query: 158 LRGIDHIKDPRLNKGLAFTLEEXKL 232 +RG D ++D LNKGLAFTLEE ++ Sbjct: 60 IRGTDIMRDSHLNKGLAFTLEERQI 84 >SB_17112| Best HMM Match : Trypsin (HMM E-Value=0) Length = 636 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +2 Query: 116 NMHEITGNIICPNML----RGIDHIKDPRLNKGLAFTLEEXK 229 N H G ++ P + +DH+KDP+ LA TL E K Sbjct: 373 NGHHCGGTLVSPQWVVTAAHCVDHVKDPKNYNELAITLGEHK 414 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,132,976 Number of Sequences: 59808 Number of extensions: 275311 Number of successful extensions: 459 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -