BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0688 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g19900.1 68415.m02326 malate oxidoreductase, putative similar... 65 4e-11 At5g25880.1 68418.m03071 malate oxidoreductase, putative similar... 60 1e-09 At5g11670.1 68418.m01364 malate oxidoreductase, putative similar... 60 1e-09 At1g79750.1 68414.m09304 malate oxidoreductase, putative similar... 56 1e-08 At4g00570.1 68417.m00080 malate oxidoreductase, putative similar... 50 9e-07 At2g13560.1 68415.m01495 malate oxidoreductase, putative similar... 50 9e-07 At4g37340.1 68417.m05289 cytochrome P450 family protein Similar ... 29 3.1 At3g29796.1 68416.m03790 hypothetical protein 28 5.4 At4g37360.1 68417.m05291 cytochrome P450 family protein cytochro... 27 9.5 At2g05290.1 68415.m00557 expressed protein similar to zinc finge... 27 9.5 >At2g19900.1 68415.m02326 malate oxidoreductase, putative similar to NADP-dependent malic enzyme (EC 1.1.1.40) (NADP-ME) (SP:P51615) {Vitis vinifera} Length = 581 Score = 64.9 bits (151), Expect = 4e-11 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +3 Query: 345 TELQDRNEKLFFSLLDCDIEKFMPIVYTPTVGLACQKFGS 464 TELQ+RNE+LF+ LL ++E+ +PIVYTPTVG ACQKFGS Sbjct: 103 TELQERNERLFYKLLIDNVEELLPIVYTPTVGEACQKFGS 142 Score = 29.1 bits (62), Expect = 2.4 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 164 GIDHIKDPRLNKGLAFTLEE 223 G ++DPR NKGLAFT +E Sbjct: 42 GYSLLRDPRYNKGLAFTEKE 61 >At5g25880.1 68418.m03071 malate oxidoreductase, putative similar to NADP-dependent malic enzyme (EC 1.1.1.40) (NADP-ME) (SP:P12628) {Phaseolus vulgaris} Length = 588 Score = 60.1 bits (139), Expect = 1e-09 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = +3 Query: 348 ELQDRNEKLFFSLLDCDIEKFMPIVYTPTVGLACQKFGS 464 +LQ+RNE+LF+ LL ++E+ +P+VYTPTVG ACQK+GS Sbjct: 111 DLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGS 149 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 164 GIDHIKDPRLNKGLAFTLEEXKL*VFTDFWPQI 262 G ++DPR NKGLAFT +E T P + Sbjct: 49 GYTLMRDPRYNKGLAFTDKERDAHYITGLLPPV 81 >At5g11670.1 68418.m01364 malate oxidoreductase, putative similar to NADP-dependent malic enzyme (EC 1.1.1.40) (NADP-ME) (SP|P12628) {Phaseolus vulgaris} Length = 588 Score = 60.1 bits (139), Expect = 1e-09 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = +3 Query: 348 ELQDRNEKLFFSLLDCDIEKFMPIVYTPTVGLACQKFGS 464 +LQ+RNE+LF+ LL ++E+ +P+VYTPTVG ACQK+GS Sbjct: 111 DLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGS 149 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 164 GIDHIKDPRLNKGLAFTLEEXKL*VFTDFWPQI 262 G ++DPR NKGLAFT +E T P + Sbjct: 49 GYTLMRDPRYNKGLAFTDKERDAHYLTGLLPPV 81 >At1g79750.1 68414.m09304 malate oxidoreductase, putative similar to malate oxidoreductase (NADP-dependent malic enzyme) GB:P34105 (Populus balsamifera subsp. trichocarpa) Length = 646 Score = 56.4 bits (130), Expect = 1e-08 Identities = 22/39 (56%), Positives = 32/39 (82%) Frame = +3 Query: 348 ELQDRNEKLFFSLLDCDIEKFMPIVYTPTVGLACQKFGS 464 +LQ+ NE+LF+ LL +E+ +P++YTPTVG ACQK+GS Sbjct: 169 DLQETNERLFYKLLIDHVEELLPVIYTPTVGEACQKYGS 207 >At4g00570.1 68417.m00080 malate oxidoreductase, putative similar to NAD-dependent malic enzyme 59 kDa isoform, mitochondrial precursor (EC 1.1.1.39) (NAD-ME) (SP:P37225) {Solanum tuberosum} Length = 607 Score = 50.4 bits (115), Expect = 9e-07 Identities = 24/55 (43%), Positives = 33/55 (60%) Frame = +3 Query: 351 LQDRNEKLFFSLLDCDIEKFMPIVYTPTVGLACQKFGSRLQETERIXYHYFMIKD 515 L DRNE L++ +L +I+ F PI+YTPTVGL CQ + + + YF KD Sbjct: 112 LHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLYRRPRGM---YFSAKD 163 >At2g13560.1 68415.m01495 malate oxidoreductase, putative similar to NAD-dependent malic enzyme 62 kDa isoform, mitochondrial precursor (EC 1.1.1.39) (NAD-ME) (SP:P37221) {Solanum tuberosum} Length = 623 Score = 50.4 bits (115), Expect = 9e-07 Identities = 20/36 (55%), Positives = 28/36 (77%) Frame = +3 Query: 351 LQDRNEKLFFSLLDCDIEKFMPIVYTPTVGLACQKF 458 L DRNE +++ +L +IE++ PIVYTPTVGL CQ + Sbjct: 119 LHDRNETMYYKVLINNIEEYAPIVYTPTVGLVCQNY 154 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 161 RGIDHIKDPRLNKGLAFTLEE 223 +G+D + DP NKG AFT+ E Sbjct: 45 QGLDILHDPWFNKGTAFTMTE 65 >At4g37340.1 68417.m05289 cytochrome P450 family protein Similar to Cytochrome P450 91A1 (SP:Q9FG65) [Arabidopsis thaliana]; Length = 500 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = -2 Query: 213 VKARPLLSRGSFIWSMPLSMFGQIMLPVISCIFLLWSKYLGCKPFIILRL 64 +K RP L S W++P+ +++ P + +FL S+ LG P I LRL Sbjct: 24 IKRRPNLPP-SPSWALPVIGHLRLLKPPLHRVFLSVSESLGDAPIISLRL 72 >At3g29796.1 68416.m03790 hypothetical protein Length = 463 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 23 FKSFLTFIFERTKFKRNIINGLQPKYLDQ 109 F +FL I T+F RN + L+ KYL Q Sbjct: 363 FATFLRGIMTSTQFPRNCLANLRGKYLSQ 391 >At4g37360.1 68417.m05291 cytochrome P450 family protein cytochrome P450 monooxygenase, Arabidopsis thaliana, PID:d1029478 Length = 499 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -2 Query: 174 WSMPLSMFGQIMLPVISCIFLLWSKYLGCKPFIILRL 64 W++P+ +++ P + +FL S+ LG P I LRL Sbjct: 36 WALPVIGHLRLLKPPLHRVFLSVSQSLGDAPIISLRL 72 >At2g05290.1 68415.m00557 expressed protein similar to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 383 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 74 IINGLQPKYLDQRRNMHEITGNIICPNMLRGIDHIKD-PRL 193 +IN QP + RN++ I G + P+ R I D PR+ Sbjct: 22 LINSDQPNFFSTERNLNSIMGRFLNPDKQRMSKWILDMPRI 62 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,844,968 Number of Sequences: 28952 Number of extensions: 197107 Number of successful extensions: 437 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 437 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -