BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0680 (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 0.85 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 1.5 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.0 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 6.0 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 24.2 bits (50), Expect = 0.85 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 126 PHGSTFRLGADSGRFSQCCSRPPCEQR 206 P+G T G D G + CS PCE + Sbjct: 88 PYGYT---GKDCGEYVDWCSTNPCENQ 111 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.4 bits (48), Expect = 1.5 Identities = 16/60 (26%), Positives = 27/60 (45%) Frame = +1 Query: 250 LGPAFKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKHEEKKDQHGYISRQFTRRYA 429 L F KD ++ D++ P+ + + G V G+ EEK ++ + TRR A Sbjct: 75 LNEQFDVIKDNYRKVTDLKKRFPKLKVLLSVGGNADVSGQDEEKNIKYRNLLETTTRRLA 134 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 524 TAGGTSWVRLQTTHHLKTAGTXQIQPLQPS 435 T G +R TT+H++ +I +PS Sbjct: 954 TEAGVFTLRPATTYHIRIVAENEIGSSEPS 983 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 110 LSVLVASWINISAWG*LRKIFSVL 181 LSV+ +S+++I+ W L K F + Sbjct: 488 LSVIKSSFLDINTWKMLVKSFDAI 511 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,563 Number of Sequences: 336 Number of extensions: 3115 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -