BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0678 (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51830| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44774| Best HMM Match : TPR_2 (HMM E-Value=6.3e-15) 35 0.064 SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_22290| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_22714| Best HMM Match : TPR_2 (HMM E-Value=1.2e-17) 32 0.45 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.59 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 31 0.59 SB_8404| Best HMM Match : TPR_1 (HMM E-Value=0) 30 1.8 SB_34109| Best HMM Match : TPR_2 (HMM E-Value=4.8e-30) 29 2.4 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 29 4.2 SB_44671| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-26) 28 5.5 SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 28 5.5 SB_50778| Best HMM Match : PA14 (HMM E-Value=0.00025) 28 7.3 SB_13361| Best HMM Match : TPR_2 (HMM E-Value=0.0021) 28 7.3 SB_16018| Best HMM Match : Antimicrobial18 (HMM E-Value=0.89) 27 9.7 >SB_51830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 49.6 bits (113), Expect = 2e-06 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = +3 Query: 405 CFIQ*SIEACPPDRPVDLATFYQNRSACYEKREMWNKLKKIALLH*NL-TKSM*SFLRRS 581 C+ + +IE CPP+ DL+TFYQNR+A YE+ + + + A L +K + +RR+ Sbjct: 163 CYTE-AIELCPPENKQDLSTFYQNRAAAYEQMNQFENVVEEATKALELNSKYTKALMRRA 221 Query: 582 RAAEKV 599 RA EK+ Sbjct: 222 RALEKL 227 Score = 33.5 bits (73), Expect = 0.15 Identities = 20/62 (32%), Positives = 32/62 (51%) Frame = +1 Query: 253 EKASELKAKTTISLDNEENTTKVSESAIERAMKLKGAGNRAFHAGEYDKAIALYNEALKH 432 EK + + K +E TT ++ S + KLKG N+ F +Y++AI Y EA++ Sbjct: 113 EKGNHEEKKAEDDGASEAKTTNMTPSEQAQVAKLKG--NKYFKGCKYEQAIKCYTEAIEL 170 Query: 433 AP 438 P Sbjct: 171 CP 172 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +2 Query: 149 STPFPKWQLAILLGAPIA---IGLGYLYLRNRLEDPEKRKHQN 268 S+ KWQ+A+L+GAP+A + Y RN E E+ + ++ Sbjct: 69 SSGLEKWQIALLIGAPVAVVCVAGAVWYWRNSQEGEEEGERED 111 >SB_44774| Best HMM Match : TPR_2 (HMM E-Value=6.3e-15) Length = 206 Score = 34.7 bits (76), Expect = 0.064 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 304 ENTTKVSESAIERAMKLKGAGNRAFHAGEYDKAIALYNEALKHAP 438 EN+ + + ++ A K GNR + Y AIALY++A++ AP Sbjct: 21 ENSPEEEQDKVKLAEAKKAEGNREYGLKNYVSAIALYSKAIEFAP 65 >SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 784 Score = 34.7 bits (76), Expect = 0.064 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +1 Query: 340 RAMKLKGAGNRAFHAGEYDKAIALYNEALKHAPQTVLSILLHFTKTALLVMKN 498 RA+ LK GN AF ++ A+ +YNEAL AP S +L+ + A + ++ Sbjct: 333 RALHLKTIGNEAFCKQQFLTAVNMYNEALNLAPN---SAVLYANRAAAFIKRS 382 >SB_22290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +1 Query: 340 RAMKLKGAGNRAFHAGEYDKAIALYNEAL 426 +A KLK GN A AG+ KAI Y EA+ Sbjct: 8 KAAKLKDQGNAALSAGDTQKAIEFYTEAI 36 >SB_22714| Best HMM Match : TPR_2 (HMM E-Value=1.2e-17) Length = 455 Score = 31.9 bits (69), Expect = 0.45 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 343 AMKLKGAGNRAFHAGEYDKAIALYNEALK 429 A+++K GN+ F AG+Y+ A++ Y ALK Sbjct: 9 AVEIKEEGNKYFKAGDYEAALSSYAAALK 37 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 31.5 bits (68), Expect = 0.59 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 355 KGAGNRAFHAGEYDKAIALYNEALKHAPQ 441 K GN AF G Y KA LY EAL+ P+ Sbjct: 37 KQEGNDAFTGGHYQKAYELYTEALEIDPK 65 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 31.5 bits (68), Expect = 0.59 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 355 KGAGNRAFHAGEYDKAIALYNEALKHAPQ 441 K GN AF G Y KA LY EAL+ P+ Sbjct: 37 KQEGNDAFTGGHYQKAYELYTEALEIDPK 65 >SB_8404| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 1981 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/55 (34%), Positives = 31/55 (56%) Frame = +1 Query: 274 AKTTISLDNEENTTKVSESAIERAMKLKGAGNRAFHAGEYDKAIALYNEALKHAP 438 AK S +++ + T+ S + K K AG+ A G++ KA+ LY+EA+K P Sbjct: 2 AKNLCSDESKVDLTEQSRPGLHE--KAKWAGD-ACSKGDFQKAVELYSEAIKLDP 53 >SB_34109| Best HMM Match : TPR_2 (HMM E-Value=4.8e-30) Length = 503 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 385 GEYDKAIALYNEALKHAP 438 G Y +A+A YN+ALKH P Sbjct: 54 GNYKQALACYNQALKHNP 71 >SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) Length = 487 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 411 IQ*SIEACPPDRPVDLATFYQNRSACYEKREMWN 512 I+ S C P+ D + YQN C KRE WN Sbjct: 272 IEKSFAECSPE---DRLSIYQNVLKCVAKREFWN 302 >SB_44671| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-26) Length = 298 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 8/50 (16%) Frame = +2 Query: 455 SCYILPK--------PLCLL*KTRNVEQVKEDCTFALKLNEKYVKLSASI 580 +CY LP +C K RN + + + FALK+ +K VKL A + Sbjct: 178 TCYTLPSLVMWYTLYQICYTLKHRNTKVIPKSQQFALKVQQKVVKLLAFV 227 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +1 Query: 295 DNEENTTKVSESAIERAMKLKGAGNRAFHAGEYDKAIALYNEALKH 432 D + + +KV E +E A KLK GN F +Y+ A Y +AL++ Sbjct: 285 DADIDFSKV-ELVVEVAEKLKVIGNEQFKQQKYEVAKKKYKKALRY 329 >SB_50778| Best HMM Match : PA14 (HMM E-Value=0.00025) Length = 1266 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +3 Query: 441 DRPVDLAT--FYQNRSACYEKREMWNKLKKIALL 536 +RP L+ F ++S CY + WN+ KIAL+ Sbjct: 1022 ERPAVLSQYIFGDSKSFCYPENLQWNRTAKIALI 1055 >SB_13361| Best HMM Match : TPR_2 (HMM E-Value=0.0021) Length = 304 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 325 ESAIERAMKLKGAGNRAFHAGEYDKAIALYNEALK 429 E+ +E A+ K GN + + KAI Y E +K Sbjct: 78 ENPVENALSYKEEGNYEYKRKNFKKAIDAYTEGIK 112 >SB_16018| Best HMM Match : Antimicrobial18 (HMM E-Value=0.89) Length = 1494 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = -3 Query: 359 PFSFMARSMALSDTLVVFSSLSKDIVVFALSSDAFSFLGLLIYFLGKGNL 210 P F+ S +LSD L + SSLS + +L SD + L FL +L Sbjct: 324 PSDFLTSSSSLSDFLSLSSSLSDFLTSSSLPSDFLTSSSSLSDFLTSSSL 373 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,829,378 Number of Sequences: 59808 Number of extensions: 388093 Number of successful extensions: 1319 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1318 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -