BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0678 (637 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20360.1 68418.m02422 octicosapeptide/Phox/Bem1p (PB1) domain... 36 0.030 At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containi... 35 0.039 At4g32070.1 68417.m04564 octicosapeptide/Phox/Bem1p (PB1) domain... 32 0.28 At1g04190.1 68414.m00409 tetratricopeptide repeat (TPR)-containi... 32 0.28 At3g17970.1 68416.m02286 chloroplast outer membrane translocon s... 31 0.64 At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 31 0.85 At5g65160.1 68418.m08195 tetratricopeptide repeat (TPR)-containi... 30 1.1 At4g12400.1 68417.m01960 stress-inducible protein, putative simi... 29 2.0 At1g56090.1 68414.m06441 tetratricopeptide repeat (TPR)-containi... 29 2.6 At1g16760.1 68414.m02013 protein kinase family protein contains ... 29 3.4 At1g78940.1 68414.m09203 protein kinase family protein contains ... 28 4.5 At5g09420.1 68418.m01091 chloroplast outer membrane translocon s... 28 6.0 At5g50830.1 68418.m06297 expressed protein 27 7.9 At3g45060.1 68416.m04857 high-affinity nitrate transporter, puta... 27 7.9 At3g19160.1 68416.m02433 adenylate isopentenyltransferase 8 / ad... 27 7.9 At1g80070.1 68414.m09373 splicing factor, putative strong simila... 27 7.9 >At5g20360.1 68418.m02422 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 809 Score = 35.5 bits (78), Expect = 0.030 Identities = 22/83 (26%), Positives = 39/83 (46%) Frame = +1 Query: 289 SLDNEENTTKVSESAIERAMKLKGAGNRAFHAGEYDKAIALYNEALKHAPQTVLSILLHF 468 +LD+ + + + + +A LK GN+ F +YD A+ Y EA+K P+ + + Sbjct: 108 TLDDCVSEVETLDDCVSKAQGLKEEGNKLFQKRDYDGAMFKYGEAIKILPKDHVEVSHVR 167 Query: 469 TKTALLVMKNEKCGTS*RRLHFC 537 A M+ E G + +H C Sbjct: 168 ANVASCYMQLEP-GEFAKAIHEC 189 >At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 798 Score = 35.1 bits (77), Expect = 0.039 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +1 Query: 337 ERAMKLKGAGNRAFHAGEYDKAIALYNEALKHAP 438 E ++ LK GN F + ++D+A+ LY++AL+ AP Sbjct: 61 ETSLDLKRRGNHCFRSRDFDEALRLYSKALRVAP 94 >At4g32070.1 68417.m04564 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 811 Score = 32.3 bits (70), Expect = 0.28 Identities = 17/57 (29%), Positives = 31/57 (54%) Frame = +1 Query: 325 ESAIERAMKLKGAGNRAFHAGEYDKAIALYNEALKHAPQTVLSILLHFTKTALLVMK 495 E I RA++LK GN+ F +++ A+ +++ALK P+ + + T A M+ Sbjct: 45 EIFISRALELKEEGNKLFQKRDHEGAMLSFDKALKLLPKDHIDVAYLRTSMASCYMQ 101 >At1g04190.1 68414.m00409 tetratricopeptide repeat (TPR)-containing protein low similarity to protein antigen LmSTI1 [Leishmania major] GI:1698880; contains Pfam profile PF00515 TPR Domain; EST gb|Z47802 and gb|Z48402 come from this gene Length = 328 Score = 32.3 bits (70), Expect = 0.28 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +1 Query: 337 ERAMKLKGAGNRAFHAGEYDKAIALYNEALKHAP 438 E LK GN F AG + KA ALY +A+K P Sbjct: 13 EAEKSLKEKGNEFFKAGNFLKAAALYTQAIKLDP 46 >At3g17970.1 68416.m02286 chloroplast outer membrane translocon subunit, putative similar to Toc64 [Pisum sativum] GI:7453538; contains Pfam profile PF00515 TPR Domain Length = 589 Score = 31.1 bits (67), Expect = 0.64 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +1 Query: 289 SLDNEENTTKVSESAIERAMKLKGAGNRAFHAGEYDKAIALYNEALK 429 S+ + ++K + + E A K GN+AF + KAI LY+EA+K Sbjct: 456 SIVTDPKSSKKAITKEESAEIAKEKGNQAFKEKLWQKAIGLYSEAIK 502 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 30.7 bits (66), Expect = 0.85 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +1 Query: 349 KLKGAGNRAFHAGEYDKAIALYNEALKHAPQ 441 ++K AGN + G Y +A+ALY+ A+ +P+ Sbjct: 213 EVKKAGNVMYRKGNYAEALALYDRAISLSPE 243 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 268 LKAKTTISLDNEENTTKVSE-SAIERAMKLKGAGNRAFHAGEYDKAIALYNEALK 429 +K + +++D+ + VS + ++ K + GN F +G Y +A Y + LK Sbjct: 423 VKVERAMTIDHSNSPEVVSVLNNVKNVAKARTRGNELFSSGRYSEASVAYGDGLK 477 >At5g65160.1 68418.m08195 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 593 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +1 Query: 298 NEENTTKVSESAIERAMKLKGAGNRAFHAGEYDKAIALYNEALKHAPQTVLSILL 462 N +S A + + + GN F +G + +A A Y E L H P+ S+LL Sbjct: 456 NNREVIMISRRA-QAVTEARFKGNELFKSGRFQEACAAYGEGLDHDPRN--SVLL 507 >At4g12400.1 68417.m01960 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 530 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 376 FHAGEYDKAIALYNEALKHAPQ 441 F EYDKA+ Y E LKH P+ Sbjct: 448 FFMKEYDKAMETYQEGLKHDPK 469 >At1g56090.1 68414.m06441 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain; similar to infertility-related sperm protein [Homo sapiens] GI:10863768, TPR-containing protein involved in spermatogenesis TPIS [Mus musculus] GI:6272680 Length = 272 Score = 29.1 bits (62), Expect = 2.6 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +1 Query: 328 SAIERAMKLKGAGNRAFHAGEYDKAIALYNEALKHAPQTVLSILLHFTKTA 480 SA+ + K++ G++ + G+Y +A+ Y EAL A I LH + A Sbjct: 3 SAVTASGKVE-KGHQLYRDGKYKEALLFYTEALTAAKAKPQKIALHSNRAA 52 >At1g16760.1 68414.m02013 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 758 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +2 Query: 146 GSTPFPKWQLAILLGAPIAIGLGYLYLRNRLEDPEKRKHQNLK 274 G+TP WQL + A IA GL +L+ PE H++LK Sbjct: 536 GNTPPISWQLRFRIAAEIATGLLFLHQTK----PEPIVHRDLK 574 >At1g78940.1 68414.m09203 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 680 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +2 Query: 146 GSTPFPKWQLAILLGAPIAIGLGYLYLRNRLEDPEKRKHQNLK 274 G+TP WQL + A IA GL +L+ PE H++LK Sbjct: 463 GNTPPITWQLRFRIAAEIATGLLFLHQTK----PEPIVHRDLK 501 >At5g09420.1 68418.m01091 chloroplast outer membrane translocon subunit, putative similar to component of chloroplast outer membrane translocon Toc64 [Pisum sativum] GI:7453538; contains Pfam profiles PF01425: Amidase, PF00515: TPR Domain Length = 603 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 334 IERAMKLKGAGNRAFHAGEYDKAIALYNEALK 429 +E + +K GN A+ +++KA+ Y EA+K Sbjct: 485 MEASEVMKEKGNAAYKGKQWNKAVNFYTEAIK 516 >At5g50830.1 68418.m06297 expressed protein Length = 281 Score = 27.5 bits (58), Expect = 7.9 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +2 Query: 194 PIAIGLGYLYLRNRLEDPEKRKHQNLKQKRQYLWIMKKTLLRY 322 P+ G+ L LR RLE+ +KR H + + Q L KK LLR+ Sbjct: 23 PLPAGIRPL-LRRRLEEMKKRSHAGVLKGSQTL--SKKELLRH 62 >At3g45060.1 68416.m04857 high-affinity nitrate transporter, putative similar to trans-membrane nitrate transporter protein AtNRT2:1 [Arabidopsis thaliana] GI:3747058, high-affinity nitrate transporter ACH1 [Arabidopsis thaliana] GI:3608362 Length = 542 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 125 FEDMASTGSTPFPKWQLAILLGAPIAIGLGYLYL 226 F + TG+TPF W+ A + + I +G L L Sbjct: 220 FHVIKLTGATPFTAWRFAFFIPGILQIVMGILVL 253 >At3g19160.1 68416.m02433 adenylate isopentenyltransferase 8 / adenylate dimethylallyltransferase / cytokinin synthase (IPT8) identical to adenylate isopentenyltransferase (IPT8) [Arabidopsis thaliana] GI:14279068 Length = 330 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 301 EENTTKVSESAIERAMKLKGAG 366 +ENT ++++ IER MKLK +G Sbjct: 268 KENTWRLAKKQIERIMKLKSSG 289 >At1g80070.1 68414.m09373 splicing factor, putative strong similarity to splicing factor Prp8 [Homo sapiens] GI:3661610; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 2382 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 426 EACPPDRPVDLATFYQNRSACYEKREMWNKLKK 524 E CPP PV + YQ CY E+ ++ K Sbjct: 479 EHCPPAYPVKVRVSYQKLLKCYVLNELHHRPPK 511 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,195,294 Number of Sequences: 28952 Number of extensions: 271949 Number of successful extensions: 849 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -