BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0672 (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 26 0.68 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 25 2.1 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 23 6.3 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 8.4 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 26.2 bits (55), Expect = 0.68 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 149 LKIKMSTPARRRLMRDFKRLQEDPPTGVSGAPTDNIL 259 ++I AR RL+ ++R Q D TG+ P N+L Sbjct: 439 VQITSGKAARNRLLTFWQRTQVDLGTGLDFGPQGNVL 475 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 24.6 bits (51), Expect = 2.1 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -2 Query: 434 GYLGRFHHRRKHLDXNIFDTNRTVGGLFG 348 G+L F K+ D N++D N+ + L+G Sbjct: 54 GFLKEFGPFGKYKDGNLYDINKRLRELYG 82 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -1 Query: 264 DHNMLSVGAPDTPVGGSSCKRLKSLIRRL 178 DH + G P PV C+ +++ +R L Sbjct: 145 DHYQVRYGRPLEPVASPVCRMMRANVRVL 173 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 22.6 bits (46), Expect = 8.4 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +1 Query: 298 PFEDGTFKLTIEFTXXYPNKPPTVRFVSKMFXSKCLRRWWNL 423 PF F++ T YPN P + F++ + K W L Sbjct: 1446 PFSGKQFQMCFSATNQYPNM-PKLNFLNVLNFDKVGSMNWEL 1486 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 536,829 Number of Sequences: 2352 Number of extensions: 9458 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -