BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0670 (459 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22530.1 68417.m03251 embryo-abundant protein-related similar... 30 0.65 At1g03920.1 68414.m00377 protein kinase, putative contains prote... 29 2.0 At5g20730.3 68418.m02464 auxin-responsive factor (ARF7) identica... 27 4.6 At5g20730.2 68418.m02463 auxin-responsive factor (ARF7) identica... 27 4.6 At5g20730.1 68418.m02462 auxin-responsive factor (ARF7) identica... 27 4.6 At5g10510.1 68418.m01217 ovule development protein, putative sim... 27 6.1 At4g19040.1 68417.m02805 pleckstrin homology (PH) domain-contain... 27 6.1 At2g21800.1 68415.m02591 expressed protein 27 6.1 At2g33320.1 68415.m04084 C2 domain-containing protein low simila... 27 8.1 At2g02440.1 68415.m00183 hypothetical protein 27 8.1 >At4g22530.1 68417.m03251 embryo-abundant protein-related similar to embryo-abundant protein [Picea glauca] GI:1350531 Length = 261 Score = 30.3 bits (65), Expect = 0.65 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 31 DWCSILLSL*WTRRHNTAWTAGQGGG 108 DW S L +L + RHN AW AG G G Sbjct: 22 DWYSKLAAL--SHRHNLAWDAGTGNG 45 >At1g03920.1 68414.m00377 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 569 Score = 28.7 bits (61), Expect = 2.0 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 79 TAWTAGQGGGSFSCSSDMPKRRRLQDLHHKLRVRR 183 T AG GGGS S S+ PKR + + L H + RR Sbjct: 296 TVGNAGSGGGSESVST-TPKRSQQEQLEHWQKNRR 329 >At5g20730.3 68418.m02464 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1150 Score = 27.5 bits (58), Expect = 4.6 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -2 Query: 119 QLNEPPPWPAVQAVLCLLVHHKDNKIEHQSQDQQQ 15 QL +PP + Q L L+H N + QSQ QQQ Sbjct: 492 QLPQPPTTLSQQQQLQQLLHSSLNHQQQQSQSQQQ 526 >At5g20730.2 68418.m02463 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1164 Score = 27.5 bits (58), Expect = 4.6 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -2 Query: 119 QLNEPPPWPAVQAVLCLLVHHKDNKIEHQSQDQQQ 15 QL +PP + Q L L+H N + QSQ QQQ Sbjct: 491 QLPQPPTTLSQQQQLQQLLHSSLNHQQQQSQSQQQ 525 >At5g20730.1 68418.m02462 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1165 Score = 27.5 bits (58), Expect = 4.6 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -2 Query: 119 QLNEPPPWPAVQAVLCLLVHHKDNKIEHQSQDQQQ 15 QL +PP + Q L L+H N + QSQ QQQ Sbjct: 492 QLPQPPTTLSQQQQLQQLLHSSLNHQQQQSQSQQQ 526 >At5g10510.1 68418.m01217 ovule development protein, putative similar to ovule development protein aintegumenta (GI:1209099) [Arabidopsis thaliana] Length = 566 Score = 27.1 bits (57), Expect = 6.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 68 LVHHKDNKIEHQSQDQQQTIF 6 L HH + +HQ Q QQQ F Sbjct: 504 LYHHHQQQQQHQQQQQQQNFF 524 >At4g19040.1 68417.m02805 pleckstrin homology (PH) domain-containing protein / lipid-binding START domain-containing protein contains Pfam profiles PF01852: START domain, PF00169: PH domain Length = 718 Score = 27.1 bits (57), Expect = 6.1 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 250 NGXEPVDPLLARAGVGSXQLQHVAGRAVYGEGLGVFVAWAYHC 122 +G + PL R G Q+QH+ + G G G A+ HC Sbjct: 333 SGGYNISPLKPRNGRPRTQVQHLIQIDLKGWGAGYLPAFQQHC 375 >At2g21800.1 68415.m02591 expressed protein Length = 475 Score = 27.1 bits (57), Expect = 6.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 247 HCWIHTKVXXANPPLQPRXQLAV 315 HC + KV A P +QPR +AV Sbjct: 371 HCQVRLKVLVAIPKVQPRYAIAV 393 >At2g33320.1 68415.m04084 C2 domain-containing protein low similarity to splicing coactivator subunit SRm300 [Homo sapiens] GI:6649242; contains Pfam profile PF00168: C2 domain Length = 602 Score = 26.6 bits (56), Expect = 8.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 67 RRHNTAWTAGQGGGSFSCSSDM 132 ++HN T G G G FSC S++ Sbjct: 542 KKHNRRHTEGGGNGLFSCFSNL 563 >At2g02440.1 68415.m00183 hypothetical protein Length = 138 Score = 26.6 bits (56), Expect = 8.1 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 73 HNTAWTAGQGGGSFSCSSDMPKRRR 147 H+ T+G+ GG CSS PK ++ Sbjct: 32 HSVCSTSGEDGGEKFCSSSKPKPKK 56 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,315,939 Number of Sequences: 28952 Number of extensions: 136842 Number of successful extensions: 398 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 762235320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -